Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID4119 | ADSPSKAGAAPYVQAFDSLLAGPVAEYLKI | Isoform 1 of Adenylyl cyclase-associated protein 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4679 | DSLLAGPVAEYLKI | Isoform 1 of Adenylyl cyclase-associated protein 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5682 | LAGPVAEYLKI | Isoform 1 of Adenylyl cyclase-associated protein 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5905 | LLAGPVAEYLKI | Isoform 1 of Adenylyl cyclase-associated protein 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6143 | LWNGQKLVTTV | Isoform 1 of Adenylyl cyclase-associated protein 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7976 | VQAFDSLLAGPVAEYLKI | Isoform 1 of Adenylyl cyclase-associated protein 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8912 | GSGPPPPPPGPPPPPVS | Adenylyl cyclase-associated protein | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9231 | SGPPPPPPGPPPPPVS | Adenylyl cyclase-associated protein | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID11560 | HAYLSKNSL | Adenylyl cyclase-associated protein 1 | Serum | NA | LC-MS | Melanoma | "Present in 4 cancer samples out of 8 cancer samples. ,Present in 1 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID12160 | SDDMKTHKNPAL | Adenylyl cyclase-associated protein 1 | Serum | 1355.6503 | LC-MS | Melanoma | "Present in 3 cancer samples out of 8 cancer samples. ,Present in 4 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID12188 | SGPKPFSAPKPQ | Adenylyl cyclase-associated protein 1 | Serum | 1239.6612 | LC-MS | Melanoma | "Present in 8 cancer samples out of 8 cancer samples. ,Present in 4 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID12429 | THKNPALKAQSGPV | Adenylyl cyclase-associated protein 1 | Serum | 1446.7943 | LC-MS | Melanoma | "Present in 7 cancer samples out of 8 cancer samples. ,Present in 4 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID12966 | SPRGPGQGSGHL | "Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1" | Plasma | 1149.577 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |