Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID6346 | NVVLQPHQNFLLF | Bactericidal permeability-increasing protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6347 | NVVLQPHQNFLLFGADV | Bactericidal permeability-increasing protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6500 | QDIMNYIVPILVLPRVNEKLQKGFPLPTPA | Bactericidal permeability-increasing protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7011 | SMVPNVGLKF | Bactericidal permeability-increasing protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7012 | SMVPNVGLKFSI | Bactericidal permeability-increasing protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7913 | VLQPHQNFLLF | Bactericidal permeability-increasing protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7914 | VLQPHQNFLLFGADVVYK | Bactericidal permeability-increasing protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8308 | YLGLSDYFFNT | Bactericidal permeability-increasing protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID13566 | AHDNLKLTI | "Fatty acid-binding protein, intestinal" | Plasma | 1024.579 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |
| CancerPDF_ID13981 | AHDNLKLTI | "Fatty acid-binding protein, intestinal" | Plasma | 1024.579 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |