Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID2015 | TPALHFK | Apolipoprotein B-100 | Serum | 812.45447 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2016 | KSHDELPR | Apolipoprotein B-100 | Serum | 980.50394 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2017 | EKSHDELPR | Apolipoprotein B-100 | Serum | 1109.54654 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2018 | AEKSHDELPR | Apolipoprotein B-100 | Serum | 1180.58365 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2019 | AASGTTGTYQEWK | Apolipoprotein B-100 | Serum | 1398.64156 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2020 | SVSDGIAALDLNAVANK | Apolipoprotein B-100 | Serum | 1656.86826 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2021 | SVSDGIAALDLNAVAN | Apolipoprotein B-100 | Serum | 1528.7733 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2022 | SGTTGTYQEWK | Apolipoprotein B-100 | Serum | 1256.56733 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2023 | IADFELPTIIVPEQTIEIPSIK | Apolipoprotein B-100 | Serum | 2465.36689 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2024 | DLKVEDIPLA | Apolipoprotein B-100 | Serum | 1111.61249 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID4299 | ANKIADFELPTIIVPEQTIEIPSIKFSVPA | Apolipoprotein B-100 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4743 | EIPSIKFSVPAGIVIPSFQALTA | Apolipoprotein B-100 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5182 | GISPLALIKGMTRPLSTLI | Apolipoprotein B-100 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6353 | NWEEEAASGLLT | Apolipoprotein B-100 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7509 | TLPDFRLPEIAIPEFIIPT | Apolipoprotein B-100 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7510 | TLPDFRLPEIAIPEFIIPTLN | Apolipoprotein B-100 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8836 | FPEVDVLTKY | Apolipoprotein B-100 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8837 | FPEVDVLTKYS | Apolipoprotein B-100 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8838 | FPEVDVLTKYSQPED | Apolipoprotein B-100 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8950 | IDDIDVRF | Apolipoprotein B-100 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8951 | IDDIDVRFQ | Apolipoprotein B-100 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8952 | IDKGQELCADYSEN | Isoform 1 of Vitamin D-binding protein | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8963 | IITTPPLKDF | Apolipoprotein B-100 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8966 | ILGSDVRVPSY | Apolipoprotein B-100 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9025 | LGSDVRVPSY | Apolipoprotein B-100 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9053 | LPSLELPVLH | Apolipoprotein B-100 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9096 | NKIADFELPTIIVPEQ | Apolipoprotein B-100 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9115 | NPYMKLAPGEL | Apolipoprotein B-100 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9164 | QFTLPKSVSDG | Apolipoprotein B-100 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9169 | QIDDIDVRF | Apolipoprotein B-100 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9222 | SDVRVPSYT | Apolipoprotein B-100 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9232 | SHDELPRTFQ | Apolipoprotein B-100 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9236 | SILGSDVRVP | Apolipoprotein B-100 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9237 | SILGSDVRVPSY | Apolipoprotein B-100 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9337 | TVGMDMDEDDDFSKW | Apolipoprotein B-100 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9338 | TVGMDMDEDDDFSKWN | Apolipoprotein B-100 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9341 | TVPVVNVEVSP | Apolipoprotein B-100 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9342 | TVPVVNVEVSPF | Apolipoprotein B-100 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9343 | TVPVVNVEVSPFTIEM | Apolipoprotein B-100 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID12381 | TAYGSTVSK | Apolipoprotein B-100 | Serum | NA | LC-MS | Melanoma | "Present in 5 cancer samples out of 8 cancer samples. ,Present in 3 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID12512 | TTYDHKNTF | Apolipoprotein B-100 | Serum | 1125.5091 | LC-MS | Melanoma | "Present in 2 cancer samples out of 8 cancer samples. ,Present in 0 healthy samples out of 4 healthy samples." | 26992070 |