Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
---|---|---|---|---|---|---|---|---|
CancerPDF_ID1973 | MEPLGRQLTSGPNQEQVSPLTLL | Alpha-2-antiplasmin | Serum | 2507.30537 | LC-MS | Colorectal cancer | NA | 21136997 |
CancerPDF_ID1974 | GFPRGDKLFGPDLKLVPPMEEDYPQFGSPK | Alpha-2-antiplasmin | Serum | 3360.68528 | LC-MS | Colorectal cancer | NA | 21136997 |
CancerPDF_ID1975 | DSFHLDEQFTVPVEMMQA | Alpha-2-antiplasmin | Serum | 2122.93398 | LC-MS | Colorectal cancer | NA | 21136997 |
CancerPDF_ID1976 | DFLQSLK | Alpha-2-antiplasmin | Serum | 849.45962 | LC-MS | Colorectal cancer | NA | 21136997 |
CancerPDF_ID1977 | DSFHLDEQFTVPVEMMQAR | Alpha-2-antiplasmin | Serum | 2279.03509 | LC-MS | Colorectal cancer | NA | 21136997 |
CancerPDF_ID1978 | MEPLGRQLTSGPNQEQVSPLTLLK | Alpha-2-antiplasmin | Serum | 2635.40034 | LC-MS | Colorectal cancer | NA | 21136997 |
CancerPDF_ID1979 | LGNQEPGGQTALK | Alpha-2-antiplasmin | Serum | 1311.67828 | LC-MS | Colorectal cancer | NA | 21136997 |
CancerPDF_ID1980 | QLTSGPNQEQVSPLTLLK | Alpha-2-antiplasmin | Serum | 1952.05786 | LC-MS | Colorectal cancer | NA | 21136997 |
CancerPDF_ID1981 | EQQDSPGNKDFLQSLK | Alpha-2-antiplasmin | Serum | 1832.89046 | LC-MS | Colorectal cancer | NA | 21136997 |
CancerPDF_ID1982 | LFGPDLKLVPPMEEDYPQFGSPK | Alpha-2-antiplasmin | Serum | 2603.29816 | LC-MS | Colorectal cancer | NA | 21136997 |
CancerPDF_ID1983 | NQEQVSPLTLLK | Alpha-2-antiplasmin | Serum | 1368.76128 | LC-MS | Colorectal cancer | NA | 21136997 |
CancerPDF_ID1984 | QLTSGPNQEQVSPLTLL | Alpha-2-antiplasmin | Serum | 1823.96289 | LC-MS | Colorectal cancer | NA | 21136997 |
CancerPDF_ID3129 | DFLQSLK | Alpha-2-antiplasmin | Plasma | 849.4596 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID3130 | RLPKLYL | Alpha-2-antiplasmin | Plasma | 901.5749 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID3131 | GDKLFGPDLK | Alpha-2-antiplasmin | Plasma | 1088.5866 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID3132 | RGDKLFGPDL | Alpha-2-antiplasmin | Plasma | 1116.5928 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID3133 | NKFDPSLTQR | Alpha-2-antiplasmin | Plasma | 1204.62 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID3134 | LGNQEPGGQTALK | Alpha-2-antiplasmin | Plasma | 1311.6783 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID3135 | NQEQVSPLTLLK | Alpha-2-antiplasmin | Plasma | 1368.7613 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID3136 | EQQDSPGNKDFLQSL | Alpha-2-antiplasmin | Plasma | 1704.7955 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID3137 | EQQDSPGNKDFLQSLK | Alpha-2-antiplasmin | Plasma | 1832.8905 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID3138 | DSFHLDEQFTVPVEMMQA | Alpha-2-antiplasmin | Plasma | 2122.934 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID3139 | DSFHLDEQFTVPVEMMQAR | Alpha-2-antiplasmin | Plasma | 2279.0351 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID3140 | MEPLGRQLTSGPNQEQVSPLTLL | Alpha-2-antiplasmin | Plasma | 2507.3054 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID3141 | MEPLGRQLTSGPNQEQVSPLTLLK | Alpha-2-antiplasmin | Plasma | 2635.4003 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID9462 | MEPLGRQLTSGP | Alpha-2-antiplasmin | Plasma | 1285.66 | MALDI-TOF | Colorectal cancer | Lower intensity in liver metastasis than control groups and an opposite trend in adenoma and CRC group. | 26379225 |