Browse result page of AntiTbPdb
The total number entries retrieved from this search are 550
ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
antitb_1205 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to INH, RIF (85) | MIC = 1.56-3.1 μg/ml or 0.83 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
antitb_1206 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to INH, RIF (7) | MIC = 1.56 μg/ml or 0.83 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
antitb_1207 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to INH, RIF, STR (86) | MIC = 1.56 μg/ml or 0.83 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
antitb_1208 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to INH, RIF, STR, FQ (136) | MIC = 0.78 μg/ml or 0.41 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
antitb_1209 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to INH, RIF, STR, FQ (133) | MIC = 0.78 μg/ml or 0.41 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
antitb_1210 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to INH, RIF, STR, FQ (189) | MIC = 3.1 μg/ml or 1.65 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
antitb_1211 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to INH, RIF, EMB, FQ (3) | MIC = 3.1 μg/ml or 1.65 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
antitb_1212 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to INH, RIF, EMB, PZA, FQ (30) | MIC = 0.78 μg/ml or 0.41 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
antitb_1213 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to INH, RIF, EMB, PZA, FQ (181) | MIC = 0.78 μg/ml or 0.41 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
antitb_1214 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to INH, RIF, STR, EMB, PZA, FQ (183) | MIC = 3.1 μg/ml or 1.65 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
antitb_1215 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to INH, RIF, STR, EMB, PZA, FQ (188) | MIC = 3.1 μg/ml or 1.65 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
antitb_1216 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis mc26020 | MIC = 0.39-0.78 μg/ml or 0.21-0.41 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
antitb_1221 | PK34 | PRVIETKVHGREVTGLARNVSEENVDRLAKRWIK | Free | Free | None | Linear | 34 | L | Cationic | Synthetic | Searched and selected from mycobacteriophage genome sequences | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv strain (ATCC 27294 | MIC = 50 μg/ml | Both | Murine macrophage-like J774A.1 | NA | NA | Four-week-old female BALB/c mice | Dose of 20 mg (5×10−6 mol)/kg BW/d, PK34 had co | Inhibits the proinflammatory factor (IFN-γ, TNF-α, MCP-1, IL-6, IL-10, IL-12) production of macrophage cells induced by TDM. | Cell wall disruption | trehalose-6,6=-dimycolate (TDM) | None | None | 2013 | 23603838 |
antitb_1223 | Human neutrophil peptide 1 (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulfide bridge: 2-30, 4-19, 9-29 | Cyclic | 30 | L | NA | Protein Derived | Human neutrophil | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | 96.5 % inhibition at 10 μg/ml | In vitro | THP-1 cells | Significant reduction in CFU | NA | None | NA | NA | NA | NA | None | None | 2013 | 23827033 |
antitb_1224 | Human neutrophil peptide 1 (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulfide bridge: 2-30, 4-19, 9-30 | Cyclic | 30 | L | NA | Protein Derived | Human neutrophil | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | 98.3 % inhibition at 15 μg/ml | In vitro | THP-1 cells | Significant reduction in CFU | NA | None | NA | NA | NA | NA | None | None | 2013 | 23827033 |
antitb_1225 | Human neutrophil peptide 1 (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulfide bridge: 2-30, 4-19, 9-31 | Cyclic | 30 | L | NA | Protein Derived | Human neutrophil | Mycobacterium tuberculosis | 36 Clinical isolates of Mycobacterium tuberculosis | 11 isolates (31%) showed greater sensitivity to HNP-1 than H37Rv strains. At 15 μg/ml, they wer completely inhibited. | In vitro | THP-1 cells | Sixteen clinical isolates had lower intracellular growth ability than the H37Rv strain. | NA | None | NA | NA | NA | NA | None | None | 2013 | 23827033 |
antitb_1228 | High Activity Binding Peptides (HABPs) | TGMAALEQYLGSGHAVIVSI | Free | Free | None | Linear | 20 | L | NA | Protein Derived | From Rv1268c protein | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | In vitro | alveolar epithelial cells A549 (ATCC No. CCL-185) | Inhibited mycobacterial entry by up to 65%. | NA | None | NA | NA | Inhibit mycobacterial entry into cells | NA | None | None | 2013 | 23993672 |
antitb_1229 | High Activity Binding Peptides (HABPs) | AVALGLASPADAAAGTMYGD | Free | Free | None | Linear | 20 | L | NA | Protein Derived | From Rv1268c protein | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | In vitro | U937 monocyte derived macrophages (ATCC No. CRL-1593.2) | Inhibited mycobacterial entry by up to 65%. | NA | None | NA | NA | Inhibit mycobacterial entry into cells | NA | None | None | 2013 | 23993672 |
antitb_1232 | (LLKK)2 | LLKKLLKK | Free | Free | None | Linear | 8 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 500 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
antitb_1233 | (LLKK)2 | LLKKLLKK | Free | Free | None | Linear | 8 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis CSU87 reistant to rifampicin, isoniazid, ethambutol, streptomycin and kanamycin | MIC > 500 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
antitb_1237 | C(LLKK)2 | CLLKKLLKK | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 500 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
antitb_1238 | C(LLKK)2 | CLLKKLLKK | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis CSU87 reistant to rifampicin, isoniazid, ethambutol, streptomycin and kanamycin | MIC > 500 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
antitb_1245 | (LLKK)2M | LLKKLLKKM | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 500 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
antitb_1246 | (LLKK)2M | LLKKLLKKM | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis CSU87 reistant to rifampicin, isoniazid, ethambutol, streptomycin and kanamycin | MIC = 125 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
antitb_1253 | M(LLKK)2M | MLLKKLLKKM | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 125 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
antitb_1254 | M(LLKK)2M | MLLKKLLKKM | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 7.81 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | Rifampicin, shows synergy | Antibacterial | 2014 | 24314557 |
antitb_1255 | M(LLKK)2M | MLLKKLLKKM | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis CSU87 reistant to rifampicin, isoniazid, ethambutol, streptomycin and kanamycin | MIC = 62.5 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
antitb_1268 | VapB30 (52-59) | ELAAIRHR | Free | Free | None | Linear | 8 | L | NA | Protein Derived | From VapB30 toxin | Mycobacterium tuberculosis | Mycobacterium tuberculosis (strain H37Rv) | NA | NA | NA | NA | NA | None | NA | NA | By disrupting the toxin-antitoxin complex (VapBC) | VapBC | None | NA | 2015 | 26150422 |
antitb_1269 | VapC30 (14-30) | DEPDAERFEAAVEADHI | Free | Free | None | Linear | 17 | L | NA | Protein Derived | From VapC30 toxin | Mycobacterium tuberculosis | Mycobacterium tuberculosis (strain H37Rv) | NA | NA | NA | NA | NA | None | NA | NA | By disrupting the toxin-antitoxin complex (VapBC) | VapBC | None | NA | 2015 | 26150422 |
antitb_1270 | VapC30 (48-56) | RFGEPGGRE | Free | Free | None | Linear | 9 | L | NA | Protein Derived | From VapC30 toxin | Mycobacterium tuberculosis | Mycobacterium tuberculosis (strain H37Rv) | NA | NA | NA | NA | NA | None | NA | NA | By disrupting the toxin-antitoxin complex (VapBC) | VapBC | None | NA | 2015 | 26150422 |
antitb_1271 | Inhibitor 1 | PK-(boroMet) | Acetylation | Free | boroMet = methionine boronic acid | Linear | 3 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 12 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
antitb_1272 | Inhibitor 2 | HK-(boroMet) | Acetylation | Free | boroMet = methionine boronic acid | Linear | 3 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 6 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
antitb_1273 | Inhibitor 3 | AK-(boroMet) | Acetylation | Free | boroMet = methionine boronic acid | Linear | 3 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 3 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
antitb_1274 | Inhibitor 4 | Ala(1-naphtyl)-K-boroLeu | Free | Free | Ala(1-naphtyl) = 1-napthylalanine, boroLeu = leucine boronic acid | Linear | 3 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 12 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
antitb_1276 | Inhibitor 5 | WK-(boroMet) | Addition of N-picolinoyl | Free | boroLeu = leucine boronic acid | Linear | 3 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 3 μM | In vitro | Myeloma cells (MM1.S) | NA | Slight toxic (25%) at 10 μM | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
antitb_1277 | Inhibitor 6 | AK-(boroMet) | Addition of N-picolinoyl | Free | boroMet = methionine boronic acid | Linear | 3 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 3 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
antitb_1278 | Inhibitor 7 | PK-(boroMet) | Addition of N-picolinoyl | Free | boroMet = methionine boronic acid | Linear | 3 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 24 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
antitb_1279 | Inhibitor 8 | K-(boroMet) | Addition of N-picolinoyl | Free | boroMet = methionine boronic acid | Linear | 2 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 6 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
antitb_1280 | Inhibitor 9 | K-(boroMet) | Addition of N-(3-Phenyl)propanoyl) | Free | boroMet = methionine boronic acid | Linear | 2 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 3 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
antitb_1281 | Inhibitor 10 | K-(boroMet) | Addition of N-(Benzyl) | Free | boroMet = methionine boronic acid | Linear | 2 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 6 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
antitb_1282 | Inhibitor 11 | K-(boroMet) | Addition of N-(2-(3,5-Difluorophenyl)acetyl) | Free | boroMet = methionine boronic acid | Linear | 2 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 6 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
antitb_1283 | Inhibitor 12 | W-(boroMet) | Addition of N-(2-(3,5-Difluorophenyl)acetyl) | Free | boroMet = methionine boronic acid | Linear | 2 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 12 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
antitb_1285 | Inhibitor 13 | K-(boroMet) | Addition of N-(1H-benzo(b)thiophene-7-carbonyl | Free | boroMet = methionine boronic acid | Linear | 2 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 12 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
antitb_1286 | Inhibitor 14 | K-(boroMet) | Addition of N-(Phenylmetanesulfonyl) | Free | boroMet = methionine boronic acid | Linear | 2 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 200 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
antitb_1287 | Bcn1Â | FVYGNGVTSILVQAQFLVNGQRRFFYTPDK | Free | Free | None | Linear | 30 | L | NA | Natural | Isolated from diverse Gram-positive bacteria species | Mycobacterium tuberculosis | Mycobacterium tuberculosis strain H37Rv | MIC90 = 0.1 mg/L | Both | Mouse macrophages | No inhibition | No cytotoxicty | None | NA | NA | Formation of pores in cell membranes | Cell envelope | None | None | 2007 | 17347179 |
antitb_1288 | Bcn2 | ATYYGNGLYCNKQKHYTWVDWNKASREIGKITVNGWVQH | Free | Free | None | Linear | 39 | L | NA | Natural | Isolated from diverse Gram-positive bacteria species | Mycobacterium tuberculosis | Mycobacterium tuberculosis strain H37Rv | MIC90 = 0.1 mg/L | Both | Mouse macrophages | No inhibition | Negligible at a concentration of 1 mg/L | None | NA | NA | Formation of pores in cell membranes | Cell envelope | None | None | 2007 | 17347179 |
antitb_1289 | Bcn3 | KTYYGTNGVHCTKNSLWGKVRLKNMKYDQNTTYMGRLQDILLGWATGAFGKTH | Free | Free | None | Linear | 53 | L | NA | Natural | Isolated from diverse Gram-positive bacteria species | Mycobacterium tuberculosis | Mycobacterium tuberculosis strain H37Rv | MIC90 = 0.1 mg/L | Both | Mouse macrophages | No inhibition | Negligible at a concentration of 1 mg/L | None | NA | NA | Formation of pores in cell membranes | Cell envelope | None | None | 2007 | 17347179 |
antitb_1290 | Bcn4 | RWYYGNGVGGVGGAAVCGLAGYVGEAKENIAGEVRKGWGMAGGFTHNKACKSFPGSGWASG | Free | Free | None | Linear | 61 | L | NA | Natural | Isolated from diverse Gram-positive bacteria species | Mycobacterium tuberculosis | Mycobacterium tuberculosis strain H37Rv | MIC90 = 0.1 mg/L | Both | Mouse macrophages | No inhibition | No cytotoxicty | None | NA | NA | Formation of pores in cell membranes | Cell envelope | None | None | 2007 | 17347179 |
antitb_1291 | Bcn5 | TTKNYGNGVCNSVNWCQCGNVWASCNLATGCAAWLCKLA | Free | Free | None | Linear | 39 | L | NA | Natural | Isolated from diverse Gram-positive bacteria species | Mycobacterium tuberculosis | Mycobacterium tuberculosis strain H37Rv | MIC90 = 0.1 mg/L | Both | Mouse macrophages | No inhibition | No cytotoxicty | C57BL/6JCit (B6) feamale mice of age 14 | 10 mg/mouse of Bcn5 | NA | Formation of pores in cell membranes | Cell envelope | None | None | 2007 | 17347179 |
antitb_1292 | Bcn5 | TTKNYGNGVCNSVNWCQCGNVWASCNLATGCAAWLCKLA | Free | Free | None | Linear | 39 | L | NA | Natural | Isolated from diverse Gram-positive bacteria species | Mycobacterium tuberculosis | Mycobacterium tuberculosis strain H37Rv | NA | Both | Mouse macrophages | No inhibition | No cytotoxicty | C57BL/6JCit (B6) feamale mice of age 15 | 10 mg/mouse of Bcn5-PhC complex | NA | Formation of pores in cell membranes | Cell envelope | Mixture of phosphatidylcholine (Ph) and cardiolipin (C) with Bcn5 | None | 2007 | 17347179 |