Browse result page of AntiTbPdb
The total number entries retrieved from this search are 550
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1091 | Seq 34 | RKFRWWVIR | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv, and the Mycobacterium tuberculosis lux strain | MIC90 = 17.8 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC50 = 190.2 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
| antitb_1093 | Seq 35 | WKIVFWWRR | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv, and the Mycobacterium tuberculosis lux strain | MIC90 = 23.3 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC50 = 186.0 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
| antitb_1095 | Seq 36 | RQRRVVIWW | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv, and the Mycobacterium tuberculosis lux strain | MIC90 = 24.7 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC50 = 197.2 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
| antitb_1097 | Seq 37 | RRWRVIVKW | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv, and the Mycobacterium tuberculosis lux strain | MIC90 = 24.7 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC50 = 98.6 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
| antitb_1099 | Seq 38 | RRWKIVVIRWRR | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv, and the Mycobacterium tuberculosis lux strain | MIC90 = 24.8 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC50 = 33.1 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
| antitb_1101 | Seq 39 | RLWRIVVIRVKR | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv, and the Mycobacterium tuberculosis lux strain | MIC90 = 25.9 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC50 = 69.2 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
| antitb_1103 | Seq 40 | RLRRIVVIRVFR | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv, and the Mycobacterium tuberculosis lux strain | MIC90 = 29.8 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC50 = 158.8 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
| antitb_1105 | Seq 41 | VRLRIRVRVIRK | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv, and the Mycobacterium tuberculosis lux strain | MIC90 = 30.1 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC50 = 20.1 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
| antitb_1107 | Seq 42 | RRYHWRIYI | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv, and the Mycobacterium tuberculosis lux strain | MIC90 = 33.2 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC50 = 176.9 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
| antitb_1109 | Seq 43 | RKWKIKWYW | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv, and the Mycobacterium tuberculosis lux strain | MIC90 = 34.5 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC50 = 91.9 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
| antitb_1111 | Seq 44 | YRLRVKWKW | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv, and the Mycobacterium tuberculosis lux strain | MIC90 = 36 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC50 = 191.9 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
| antitb_1113 | Seq 45 | WKWRVRVTI | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv, and the Mycobacterium tuberculosis lux strain | MIC90 = 51.5 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC50 = 206.0 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
| antitb_1115 | Seq 46 | RTKKWIVWI | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv, and the Mycobacterium tuberculosis lux strain | MIC90 = 78.1 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC50 = 208.3 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
| antitb_1117 | Seq 47 | NWRKLYRRK | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv, and the Mycobacterium tuberculosis lux strain | MIC90 = 109.3 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC50 = 174.9 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
| antitb_1119 | Seq 48 | YKFRWRIYI | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv, and the Mycobacterium tuberculosis lux strain | MIC90 = 130 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC50 =173.3 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
| antitb_1121 | Seq 49 | KRKKRFKWW | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv, and the Mycobacterium tuberculosis lux strain | MIC90 = 141 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC90 = 188.0 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
| antitb_1123 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Amidation | None | Linear | 39 | L | Amphipathic | Natural | Isolated from porcine leucocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv (ATCC 25618) | 50 mg/L causes 80% growth inhibition of m. tuberculosis H37Rv | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
| antitb_1124 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Amidation | None | Linear | 39 | L | Amphipathic | Natural | Isolated from porcine leucocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv (ATCC 25618) | MIC50 = 17 ± 9 mg/L | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
| antitb_1125 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Amidation | None | Linear | 39 | L | Amphipathic | Natural | Isolated from porcine leucocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv (ATCC 25618) | 6.25 mg/L causes 30% growth inhibition of M. tuberculosis H37Rv | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
| antitb_1126 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Amidation | None | Linear | 39 | L | Amphipathic | Natural | Isolated from porcine leucocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis E1380/94 MDR (Isoniazid, rifampicin, streptomycin, ethambutol) strain | 50 mg/L causes 39 % growth inhibition | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
| antitb_1127 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Amidation | None | Linear | 39 | L | Amphipathic | Natural | Isolated from porcine leucocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis E1380/94 MDR (Isoniazid, rifampicin, streptomycin, ethambutol) strain | MIC50 = 93 ± 12 mg/L | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
| antitb_1128 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Amidation | None | Linear | 39 | L | Amphipathic | Natural | Isolated from porcine leucocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis P34/95 MDR (isoniazid and rifampicin) strain | 50 mg/L causes 49 % growth inhibition | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
| antitb_1129 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Amidation | None | Linear | 39 | L | Amphipathic | Natural | Isolated from porcine leucocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis #894-D11 streptomycin resistant strain | 50 mg/L causes 80% growth inhibition | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
| antitb_1130 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Amidation | None | Linear | 39 | L | Amphipathic | Natural | Isolated from porcine leucocytes | Mycobacterium tuberculosis | BTB 98-492 drug suspectible swedish clinical isolate | 50 mg/L causes 80% growth inhibition | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
| antitb_1132 | Human neutrophil defensin (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Internal disulphide bond (cys2-cys30, cys4-cys19,cys9-cys29) | Cyclic | 30 | L | Cationic | Protein Derived | From the human defensin protein found in granules of neutrophils. | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv (ATCC 25618) | 50 mg/L causes approx 70 % growth inhibition | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
| antitb_1133 | Human neutrophil defensin (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Internal disulphide bond (cys2-cys30, cys4-cys19,cys9-cys29) | Cyclic | 30 | L | Cationic | Protein Derived | From the human defensin protein found in granules of neutrophils. | Mycobacterium tuberculosis | Mycobacterium tuberculosis E1380/94 MDR (Isoniazid, rifampicin, streptomycin, ethambutol) strain | 50 mg/L causes approx 30 % growth inhibition | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
| antitb_1134 | Protegrin-1 (PG-1) | RGGRLCYCRRRFCVCVGR | Free | Free | Internal disulphide bond (between Cys 6-15 and Cys 8-13) | Cyclic | 18 | L | Cationic | Natural | Isolated from porcine leukocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv (ATCC 25618) | 50 mg/L causes approx 65 % growth inhibition | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
| antitb_1135 | Protegrin-1 (PG-1) | RGGRLCYCRRRFCVCVGR | Free | Free | Internal disulphide bond (between Cys 6-15 and Cys 8-13) | Cyclic | 18 | L | Cationic | Natural | Isolated from porcine leukocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis E1380/94 MDR (Isoniazid, rifampicin, streptomycin, ethambutol) strain | 50 mg/L causes approx 39 % growth inhibition | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
| antitb_1145 | Nisin A | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region due to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Ra | NA | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
| antitb_1150 | Nisin V | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANVK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Ra | 10% decrease in relative growth as compared to Nicin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
| antitb_1155 | Nisin S | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMS-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Ra | 26% reductions in growth, relative to that brought about by nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
| antitb_1160 | Nisin T | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMT-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Ra | 24% more inhibition as compared to nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
| antitb_1183 | SL3 | AAARIRHEGVFLLIGNSCFSLPRNGPQLLLLAW | Free | Free | None | Linear | 33 | L | NA | Natural | Isolated from lung cDNA library | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | 45% reduction in growth was observed | Both | THP-1 cells | Drastic reduction (~80%) in M.tb intracellular survival after 72 hrs of infection | No cytotoxicty | BALB/c female mice at 6–8 weeks of age | NA | NA | Disruption in mycobacterila secretory and cell wall biosynthetic pathway | Molecules specific to mycobacterial cell | None | None | 2014 | 25349777 |
| antitb_1184 | H37Rv/SL3 | AAARIRHEGVFLLIGNSCFSLPRNGPQLLLLAW | Free | 6-histidine | None | Linear | 33 | L | NA | Natural | Expressing SL3-His6X endogenously | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | 45% reduction in growth was observed | Both | THP-1 cells | Drastic reduction (~80%) in M.tb intracellular survival after 72 hrs of infection | No cytotoxicty | BALB/c female mice at 6–8 weeks of age | NA | NA | Disruption in mycobacterila secretory and cell wall biosynthetic pathway | Molecules specific to mycobacterial cell | Endogenously produced with in M.tb | None | 2014 | 25349777 |
| antitb_1185 | Pin2 | FWGALAKGALKLIPSLFSSFSKKD | Free | Free | None | Linear | 24 | L | Cationic | Natural | Venom of the African scorpion Pandinus imperator | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 57.7 ± 22.3 μg/ml or 22.1 ± 8.6 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 3.3 [1.9–5.7]) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1186 | Pin2 | FWGALAKGALKLIPSLFSSFSKKD | Free | Free | None | Linear | 24 | L | Cationic | Natural | Venom of the African scorpion Pandinus imperator | Mycobacterium tuberculosis | Mycobacterium tuberculosis muti-drug resistant strain (MDR) clinical isolate | MIC = 86.5 μg/ml or 33.1 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 3.3 [1.9–5.7]) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1187 | Pin2 [G] | FWGALAKGALKLIGSLFSSFSKKD | Free | Free | None | Linear | 24 | L | Cationic | Synthetic | Amino acid substitution at one postion of Pin2 (P at 14 by G) | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 48.1 μg/ml or 18.7 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 1.4 [0.4–4.3] ) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1188 | Pin2 [G] | FWGALAKGALKLIGSLFSSFSKKD | Free | Free | None | Linear | 24 | L | Cationic | Synthetic | Amino acid substitution at one postion of Pin2 (P at 14 by G) | Mycobacterium tuberculosis | Mycobacterium tuberculosis muti-drug resistant strain (MDR) clinical isolate | MIC = 48.1 μg/ml or 18.7 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 1.4 [0.4–4.3] ) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1189 | Pin2 [GPG] | FWGALAKGALKLIGPGSLFSSFSKKD | Free | Free | None | Linear | 26 | L | Cationic | Synthetic | Amino acid substitution at one postion of Pin2 (P at 14 by GPG) | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 80.1 ± 24.8 μg/ml or 29 ± 9 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 46.6 [34–64] ) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1190 | Pin2 [GPG] | FWGALAKGALKLIGPGSLFSSFSKKD | Free | Free | None | Linear | 26 | L | Cationic | Synthetic | Amino acid substitution at one postion of Pin2 (P at 14 by GPG) | Mycobacterium tuberculosis | Mycobacterium tuberculosis muti-drug resistant strain (MDR) clinical isolate | MIC = 48.1 μg/ml or 17.4 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 46.6 [34–64] ) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1191 | Pin2 [14] | FWGLKGLKKFSKKL | Free | Free | None | Linear | 14 | L | Cationic | Synthetic | Short variant of Pin2 | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 20 ± 6.92 μg/ml or 11.92 ± 3.7 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 418.4 [291–602]) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1192 | Pin2 [14] | FWGLKGLKKFSKKL | Free | Free | None | Linear | 14 | L | Cationic | Synthetic | Short variant of Pin3 | Mycobacterium tuberculosis | Mycobacterium tuberculosis muti-drug resistant strain (MDR) clinical isolate | MIC = 10 ± 3.1 μg/ml or 6 ± 1.8 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 418.4 [291–602]) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1193 | Pin2 [17] | FWGLKGLKGPGKFSKKL | Free | Free | None | Linear | 17 | L | Cationic | Synthetic | Short variant of Pin3 | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 22 ± 4.9 μg/ml or 11.65 ± 2.59 μM | In vitro | RBC | NA | No cytotoxicty, No Hemolysis | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1194 | Pin2 [17] | FWGLKGLKGPGKFSKKL | Free | Free | None | Linear | 17 | L | Cationic | Synthetic | Short variant of Pin4 | Mycobacterium tuberculosis | Mycobacterium tuberculosis muti-drug resistant strain (MDR) clinical isolate | MIC = 28.0 ± 9.8 μg/ml or 14.85 ± 5.2 μM | In vitro | RBC | NA | No cytotoxicty, No Hemolysis | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1197 | Boropentapeptide | AVKAA-B(OH)2 | Free | Conjugated with Boronic acid | Conjugated with Boronic acid | Linear | 5 | L | NA | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Poorer inhibition than Pinanediol PD-protected Boropentapeptide | In vitro | None | NA | NA | None | NA | NA | Inhibit enzyme (MycP1) reponsible for cleavage of virulence factor (ESX secretion-associated protein B (EspB)) | Mycosin protease-1 (MycP1) | None | None | 2014 | 24915878 |
| antitb_1200 | Pinanediol PD-protected Boropentapeptide | AVKAA-BO2(PD) | Free | Conjugated with Boronic acid and pinanediol PD | Conjugated with Boronic acid and pinanediol PD | Linear | 5 | L | NA | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | IC50 = 37.9±5.2 μM for MycP3 | In vitro | None | NA | NA | None | NA | NA | Inhibit enzyme (MycP1) reponsible for cleavage of virulence factor (ESX secretion-associated protein B (EspB)) | Mycosin protease-1 (MycP1) | None | None | 2014 | 24915878 |
| antitb_1201 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 0.78–1.56 μg/ml or 0.41–0.83 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
| antitb_1202 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis susceptible 186 clinical isolate | MIC = 1.56 μg/ml or 0.83 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
| antitb_1203 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis susceptible 83 clinical isolate | MIC = 1.56-3.1 μg/ml or 0.83 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
| antitb_1204 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to INH, STR (84) | MIC = 1.56-3.1 μg/ml or 0.83 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |