Browse result page of AntiTbPdb
The total number entries retrieved from this search are 25
ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
antitb_1256 | Eosinophil Cationic Protein (RNase 3) | RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNN | Free | Free | Disulphide linkage | Cyclic | 70 | L | Cationic | Natural | Secreted by eosinophil secondary granules | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | MIC = 20.0 ± 1.0 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
antitb_1257 | Eosinophil Cationic Protein (RNase 3) | RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNN | Free | Free | Disulphide linkage | Cyclic | 70 | L | Cationic | Natural | Secreted by eosinophil secondary granules | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | IC50 = 11.6 ± 0.2 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
antitb_1258 | RNase 7 | KPKGMTSSQWFKIQHMOPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKN | Free | Free | Disulphide linkage | Cyclic | 68 | L | Cationic | Natural | Secreted by innate cells during host defense | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | MIC = 20.0 ± 0.5 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
antitb_1259 | RNase 7 | KPKGMTSSQWFKIQHMOPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKN | Free | Free | Disulphide linkage | Cyclic | 68 | L | Cationic | Natural | Secreted by innate cells during host defense | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | IC50 = 9.3 ± 1.2 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
antitb_1260 | RN3 (1-45) | RPPQFTRAQWFAIQHISLNPPRSTIAMRAINNYRWRSKNQNTFLR | Free | Free | None | Linear | 45 | L | Cationic | Protein Derived | From the N terminus of RNase 3 | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | MIC = 10.0 ± 0.5 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
antitb_1261 | RN3 (1-45) | RPPQFTRAQWFAIQHISLNPPRSTIAMRAINNYRWRSKNQNTFLR | Free | Free | None | Linear | 45 | L | Cationic | Protein Derived | From the N terminus of RNase 4 | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | IC50 = 4.2 ± 0.2 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
antitb_1262 | RN7 (1-45) | KPKGMTSSQWFKIQHMQPSPQASNSAMKNINKHTKRSKDLNTFLH | Free | Free | None | Linear | 45 | L | Cationic | Protein Derived | From the N terminus of RNase 7 | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | MIC = 20.0 ± 0.8 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
antitb_1263 | RN7 (1-45) | KPKGMTSSQWFKIQHMQPSPQASNSAMKNINKHTKRSKDLNTFLH | Free | Free | None | Linear | 45 | L | Cationic | Protein Derived | From the N terminus of RNase 8 | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | IC50 = 9.5 ± 0.3 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
antitb_1289 | Bcn3 | KTYYGTNGVHCTKNSLWGKVRLKNMKYDQNTTYMGRLQDILLGWATGAFGKTH | Free | Free | None | Linear | 53 | L | NA | Natural | Isolated from diverse Gram-positive bacteria species | Mycobacterium tuberculosis | Mycobacterium tuberculosis strain H37Rv | MIC90 = 0.1 mg/L | Both | Mouse macrophages | No inhibition | Negligible at a concentration of 1 mg/L | None | NA | NA | Formation of pores in cell membranes | Cell envelope | None | None | 2007 | 17347179 |
antitb_1290 | Bcn4 | RWYYGNGVGGVGGAAVCGLAGYVGEAKENIAGEVRKGWGMAGGFTHNKACKSFPGSGWASG | Free | Free | None | Linear | 61 | L | NA | Natural | Isolated from diverse Gram-positive bacteria species | Mycobacterium tuberculosis | Mycobacterium tuberculosis strain H37Rv | MIC90 = 0.1 mg/L | Both | Mouse macrophages | No inhibition | No cytotoxicty | None | NA | NA | Formation of pores in cell membranes | Cell envelope | None | None | 2007 | 17347179 |
antitb_1541 | RNase3 | RPPQFTRAQWFAIQHISLMPPRCTIAMRAINNYRWRCKNQNTFLR | Free | Free | None | Linear | 45 | L | Cationic | Protein derived | Derived from eisinophilic cationic protein (ECP) | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 20 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Disrupt the mycobacterial membrane | NA | NA | Bactericidal against pseudomonas and staphylococcus at pH 5.5 | 2015 | 25613372 |
antitb_1542 | RNAse7 | RPPQFTRAQWFAIQHISLMPPRCTIAMRAINNYRWRCKNQNTFLR | Free | Free | None | Linear | 45 | L | Cationic | Protein derived | Derived from eisinophilic cationic protein (ECP) | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 10 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Disrupt the mycobacterial membrane | NA | NA | Bactericidal against pseudomonas and staphylococcus at pH 5.5 | 2015 | 25613372 |
antitb_1543 | RNAse7 | RPPQFTRAQWFAIQHISLMPPRCTIAMRAINNYRWRCKNQNTFLR | Free | Free | None | Linear | 45 | L | Cationic | Protein derived | Derived from eisinophilic cationic protein (ECP) | Mycobacterium vaccae | Mycobacterium vaccae | MIC = 10 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Disrupt the mycobacterial membrane | NA | NA | Bactericidal against pseudomonas and staphylococcus at pH 5.5 | 2015 | 25613372 |
antitb_1557 | Vgf-1 | ECYRKSDIVTCEPWQKFCYREVTFFPNHPVYLSGCASECTETNSKWCCTTDKCNRARGG | Free | Free | None | Linear | 59 | L | NA | Natural | Derived from snake venom N.atra | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC25618 (resistant to INH) DR-i | MIC = 8.5 ± 0.1 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2003 | 12927960 |
antitb_1558 | Vgf-1 | ECYRKSDIVTCEPWQKFCYREVTFFPNHPVYLSGCASECTETNSKWCCTTDKCNRARGG | Free | Free | None | Linear | 59 | L | NA | Natural | Derived from snake venom N.atra | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC25618 (resistant to INH+Rif) DR-ir | MIC = 8.5 ± 0.1 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2004 | 12927960 |
antitb_1559 | Vgf-1 | ECYRKSDIVTCEPWQKFCYREVTFFPNHPVYLSGCASECTETNSKWCCTTDKCNRARGG | Free | Free | None | Linear | 59 | L | NA | Natural | Derived from snake venom N.atra | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC25618 (resistant to INH+Streptomycin) DR-is | MIC = 8.5 ± 0.1 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2005 | 12927960 |
antitb_1560 | Vgf-1 | ECYRKSDIVTCEPWQKFCYREVTFFPNHPVYLSGCASECTETNSKWCCTTDKCNRARGG | Free | Free | None | Linear | 59 | L | NA | Natural | Derived from snake venom N.atra | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC25618 (resistant to INH+Streptomycin) DR-is | MIC = 8.5 ± 0.1 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2006 | 12927960 |
antitb_1561 | Vgf-1 | ECYRKSDIVTCEPWQKFCYREVTFFPNHPVYLSGCASECTETNSKWCCTTDKCNRARGG | Free | Free | None | Linear | 59 | L | NA | Natural | Derived from snake venom N.atra | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC25618 (resistant to INH+Rif+Streptomycin) DR-irs | MIC = 8.5 ± 0.1 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2007 | 12927960 |
antitb_1562 | Vgf-1 | ECYRKSDIVTCEPWQKFCYREVTFFPNHPVYLSGCASECTETNSKWCCTTDKCNRARGG | Free | Free | None | Linear | 59 | L | NA | Natural | Derived from snake venom N.atra | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC25618 (resistant to INH+Rif+Streptomycin+ehambutol) DR-irse | MIC = 8.5 ± 0.1 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2008 | 12927960 |
antitb_1777 | Mitogenic defensin | MEKKSFAGLCFLFLVLFVAQECVLQTEAKTCENLADTFRGPCFATGNCDDHCKNKEHLLRGRCRDDFRCWCTRNC | Free | Free | Disulfide linkage | Cyclic | 75 | L | Cationic | Natural | From the seeds of white cloud beans (Phaseolus vulgaris cv. ‘white cloud bean’) | Mycobacterium phlei | Mycobacterium phlei | IC50 = 86 ± 6 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial, Antifungal | 2006 | 16687191 |
antitb_1810 | Mcdef | GFGCPNDYSCSNHCRDSIGCRGGYCKYQLICTCYGCKKRRSIQE | Free | Free | 4 disulfide linkages between 4-25, 10-31, 14-33, 20-36 | Cyclic | 44 | L | Cationic | Protein Derived | detected in hemocytes of Manila clams (Ruditapes philippinarum). | Mycobacterium fortuitum | Mycobacterium fortuitum | MIC >20 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Staphylococcus aureus KCTC 1916, Streptococcus iniae KCTC 3651, orynebacterium diphtheriae, Bacillus subtilis, ibrio logei KCCM 12281, Vibrio salmonicida KCCM 41663) | 2011 | 21945146 |
antitb_1915 | Laterosporulin 10 | ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEWGGPCQL | Free | Free | Disulphide bond between residues 2-43, 6-35 and 20-51 | Cyclic | 53 | D | Cationic | Natural | Derived from Brevibacillus species SKDU10 | Mycobacterium smegmatis | Mycobacterium smegmatis MC2 155 | MIC = 45 μM | In vitro and ex vivo | RAW 264.7 murine macrophage | NA | No cytotoxicity upto 40 μM/ml concentration | NA | NA | NA | NA | Cell wall pore formation | 0.00625 μM of rifampicin with 0.25 μM of peptide, a fourfold reduction in MIC of rifampicin against H37 RV | Antibacterial against Staphylococcus aureus MTCC 1430, Bacillus subtilis MTCC 121, Pseudomonas aeruginosa MTCC 1934, Vibrio cholerae MTCC 3904, Escherichia coli MTCC 1610 | 2016 | 27267959 |
antitb_1972 | Granulysin | RLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL | Free | Free | None | Linear | 123 | Mix | Cationic | Natural | Homo sapiens | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 90% Killing | In vivo | CD8+ T | NA | NA | NA | NA | NA | Altering Membrane Permeability | cell wall (lipid bilayer) | Perforin (2000 U/ml)+granulysin (25 µM) | Cryptococcus neoformans, Candida albicans, Leishmania major, S. typhimurium, L. monocytogenes, E. coli, and Staphylococcus aureus | 1988 | 9756476 |
antitb_1973 | Granulysin | RLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL | Free | Free | None | Linear | 123 | Mix | Cationic | Natural | Homo sapiens | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 10-15% Killing | In vivo | CD8+ T | NA | NA | NA | NA | NA | Altering Membrane Permeability | cell wall (lipid bilayer) | NA | Cryptococcus neoformans, Candida albicans, Leishmania major, S. typhimurium, L. monocytogenes, E. coli, and Staphylococcus aureus | 1988 | 9756476 |
antitb_1989 | Ds-defensin | VPAESEAAHLRVRRGFGCPLNQGACHNHCRSIRRRGGYCSGIIKQTCTCYRN | Free | Free | None | Linear | 52 | L | NA | Natural | Dermacentor silvarum | Mycobacterium bovis | Mycobacterium bovis (carbenicillin-resistant strain) | MIC= 20 µM | In vitro | NA | NA | NA | NA | NA | NA | Bacterial lycis | Cell wall | NA | Four Gram-positive bacteria, namely, Staphylococcus aureus (CMCC26003), Bacillus pumilus (CMCC63202), Micrococcus luteus (CMCC63202), and Mycobacterium bovis (carbenicillin-resistant strain); and three Gram-negative bacteria, namely, Salmonella typhimurium (CVCC542), Pseudomonas aeruginosa (CVCC2000), and Escherichia coli (CMCC44103), | 2015 | 25588982 |