Browse result page of AntiTbPdb
The total number entries retrieved from this search are 279
ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
antitb_1002 | Ecumicin | (N,N-Me2-Val)-(Val)-(N-Me-allo-Ilu)-(Thr)-(N-Me-Thr)-(Val)-(N-Me-Leu)-(Val)-(N-Me-Val)-(N-Me-4-OMe-Trp)-(Val)-(Ph-threo-Ser)-(Val) | Free | Free | N-methylation pattern, N-Me-Val = N-methyl-valine, N,N-Me2-Val = N,N-dimethyl-valine, N-Me-Thr = N-methyl-threonine, N-Me-Leu = N-methyl-leucine, N-Me-allo-Ilu = N-methyl-isoleucine, N-Me-4-OMe-Trp = N-methyl-4-methoxy-tryptophan, Ph-threo-Ser = Phe | Macrocyclic | 13 | L | NA | Natural | Produced by a genetically distinct Nonomuraea species, strain MJM5123. | Mycobacterium tuberculosis | Mycobacterium tuberculosis strain H37Rv (ATCC 27294) | MIC = 0.16 μM | Both | Vero cells (ATCC CRL-1586), J774.1 macrophage cell line, Caco-2 cell monolayers | 0.12 μM, ecumicin reduced M. tuberculosis viabilities in J774 macrophages by 2 x log10 | >63 μM for vero cells | Female BALB/c mice, male CD-1 mice | 20 mg/kg causes reductions in M. tuberculosis lung | NA | Ecumicin markedly enhanced the ATPase activity of wild-type (WT) ClpC1 but prevented activation of proteolysis by ClpC1. so toxic proteins which are normally degraded by the ClpC1P1P2 complex, accumulate in the presence of ecumicin | ClpC1 ATPase complex | Ecumicin encapsulated in micelles distributes to mouse lung tissue | NA | 2015 | 25421483 |
antitb_1003 | Ecumicin | (N,N-Me2-Val)-(Val)-(N-Me-allo-Ilu)-(Thr)-(N-Me-Thr)-(Val)-(N-Me-Leu)-(Val)-(N-Me-Val)-(N-Me-4-OMe-Trp)-(Val)-(Ph-threo-Ser)-(Val) | Free | Free | N-methylation pattern, N-Me-Val = N-methyl-valine, N,N-Me2-Val = N,N-dimethyl-valine, N-Me-Thr = N-methyl-threonine, N-Me-Leu = N-methyl-leucine, N-Me-allo-Ilu = N-methyl-isoleucine, N-Me-4-OMe-Trp = N-methyl-4-methoxy-tryptophan, Ph-threo-Ser = Phe | Macrocyclic | 13 | L | NA | Natural | Produced by a genetically distinct Nonomuraea species, strain MJM5123. | Mycobacterium tuberculosis | Mycobacterium tuberculosis strain H37Rv (ATCC 27294) | MIC = 0.16 μM | Both | Vero cells (ATCC CRL-1586), J774.1 macrophage cell line, Caco-2 cell monolayers | 0.12 μM, ecumicin reduced M. tuberculosis viabilities in J774 macrophages by 2 x log10 | >63 μM for vero cells | Female BALB/c mice, male CD-1 mice | 32 mg/kg reductions in M. tuberculosis lung CFU 1. | NA | Ecumicin markedly enhanced the ATPase activity of wild-type (WT) ClpC1 but prevented activation of proteolysis by ClpC1. so toxic proteins which are normally degraded by the ClpC1P1P2 complex, accumulate in the presence of ecumicin | ClpC1 ATPase complex | Ecumicin encapsulated in micelles distributes to mouse lung tissue | NA | 2015 | 25421483 |
antitb_1004 | Ecumicin | (N,N-Me2-Val)-(Val)-(N-Me-allo-Ilu)-(Thr)-(N-Me-Thr)-(Val)-(N-Me-Leu)-(Val)-(N-Me-Val)-(N-Me-4-OMe-Trp)-(Val)-(Ph-threo-Ser)-(Val) | Free | Free | N-methylation pattern, N-Me-Val = N-methyl-valine, N,N-Me2-Val = N,N-dimethyl-valine, N-Me-Thr = N-methyl-threonine, N-Me-Leu = N-methyl-leucine, N-Me-allo-Ilu = N-methyl-isoleucine, N-Me-4-OMe-Trp = N-methyl-4-methoxy-tryptophan, Ph-threo-Ser = Phe | Macrocyclic | 13 | L | NA | Natural | Produced by a genetically distinct Nonomuraea species, strain MJM5123. | Mycobacterium tuberculosis | Mycobacterium tuberculosis strain H37Rv (ATCC 27294) | MIC = 0.16 μM | Both | Vero cells (ATCC CRL-1586), J774.1 macrophage cell line, Caco-2 cell monolayers | 0.12 μM, ecumicin reduced M. tuberculosis viabilities in J774 macrophages by 2 x log10 | >63 μM for vero cells | Female BALB/c mice, male CD-1 mice | Complete inhibition of M. tuberculosis growth in t | NA | Ecumicin markedly enhanced the ATPase activity of wild-type (WT) ClpC1 but prevented activation of proteolysis by ClpC1. so toxic proteins which are normally degraded by the ClpC1P1P2 complex, accumulate in the presence of ecumicin | ClpC1 ATPase complex | Ecumicin encapsulated in micelles distributes to mouse lung tissue | NA | 2015 | 25421483 |
antitb_1005 | Ecumicin | (N,N-Me2-Val)-(Val)-(N-Me-allo-Ilu)-(Thr)-(N-Me-Thr)-(Val)-(N-Me-Leu)-(Val)-(N-Me-Val)-(N-Me-4-OMe-Trp)-(Val)-(Ph-threo-Ser)-(Val) | Free | Free | N-methylation pattern, N-Me-Val = N-methyl-valine, N,N-Me2-Val = N,N-dimethyl-valine, N-Me-Thr = N-methyl-threonine, N-Me-Leu = N-methyl-leucine, N-Me-allo-Ilu = N-methyl-isoleucine, N-Me-4-OMe-Trp = N-methyl-4-methoxy-tryptophan, Ph-threo-Ser = Phe | Macrocyclic | 13 | L | NA | Natural | Produced by a genetically distinct Nonomuraea species, strain MJM5123. | Mycobacterium tuberculosis | Mycobacterium tuberculosis Erdman (ATCC 35801) | MIC = 0.16 μM | Both | J774.1 macrophage cell line | 0.12 μM, ecumicin reduced M. tuberculosis viabilities in J774 macrophages by 2 x log10 | >63 μM for J774.1 cells | Female BALB/c mice, male CD-1 mice | 20 mg/kg causes reductions in M. tuberculosis lung | NA | Ecumicin markedly enhanced the ATPase activity of wild-type (WT) ClpC1 but prevented activation of proteolysis by ClpC1. so toxic proteins which are normally degraded by the ClpC1P1P2 complex, accumulate in the presence of ecumicin | ClpC1 ATPase complex | Ecumicin encapsulated in micelles distributes to mouse lung tissue | NA | 2015 | 25421483 |
antitb_1006 | Ecumicin | (N,N-Me2-Val)-(Val)-(N-Me-allo-Ilu)-(Thr)-(N-Me-Thr)-(Val)-(N-Me-Leu)-(Val)-(N-Me-Val)-(N-Me-4-OMe-Trp)-(Val)-(Ph-threo-Ser)-(Val) | Free | Free | N-methylation pattern, N-Me-Val = N-methyl-valine, N,N-Me2-Val = N,N-dimethyl-valine, N-Me-Thr = N-methyl-threonine, N-Me-Leu = N-methyl-leucine, N-Me-allo-Ilu = N-methyl-isoleucine, N-Me-4-OMe-Trp = N-methyl-4-methoxy-tryptophan, Ph-threo-Ser = Phe | Macrocyclic | 13 | L | NA | Natural | Produced by a genetically distinct Nonomuraea species, strain MJM5123. | Mycobacterium tuberculosis | Mycobacterium tuberculosis Erdman (ATCC 35801) | MIC = 0.16 μM | Both | J774.1 macrophage cell line | 0.12 μM, ecumicin reduced M. tuberculosis viabilities in J774 macrophages by 2 x log10 | >63 μM for J774.1 cells | Female BALB/c mice, male CD-1 mice | 32 mg/kg reductions in M. tuberculosis lung CFU 1. | NA | Ecumicin markedly enhanced the ATPase activity of wild-type (WT) ClpC1 but prevented activation of proteolysis by ClpC1. so toxic proteins which are normally degraded by the ClpC1P1P2 complex, accumulate in the presence of ecumicin | ClpC1 ATPase complex | Ecumicin encapsulated in micelles distributes to mouse lung tissue | NA | 2015 | 25421483 |
antitb_1007 | Ecumicin | (N,N-Me2-Val)-(Val)-(N-Me-allo-Ilu)-(Thr)-(N-Me-Thr)-(Val)-(N-Me-Leu)-(Val)-(N-Me-Val)-(N-Me-4-OMe-Trp)-(Val)-(Ph-threo-Ser)-(Val) | Free | Free | N-methylation pattern, N-Me-Val = N-methyl-valine, N,N-Me2-Val = N,N-dimethyl-valine, N-Me-Thr = N-methyl-threonine, N-Me-Leu = N-methyl-leucine, N-Me-allo-Ilu = N-methyl-isoleucine, N-Me-4-OMe-Trp = N-methyl-4-methoxy-tryptophan, Ph-threo-Ser = Phe | Macrocyclic | 13 | L | NA | Natural | Produced by a genetically distinct Nonomuraea species, strain MJM5123. | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv strains with monoresistance to isoniazid (INH) (ATCC 35822) | MIC <0.12 μM | In vitro | None | NA | NA | None | None | NA | Ecumicin markedly enhanced the ATPase activity of wild-type (WT) ClpC1 but prevented activation of proteolysis by ClpC1. so toxic proteins which are normally degraded by the ClpC1P1P2 complex, accumulate in the presence of ecumicin | ClpC1 ATPase complex | None | NA | 2015 | 25421483 |
antitb_1008 | Ecumicin | (N,N-Me2-Val)-(Val)-(N-Me-allo-Ilu)-(Thr)-(N-Me-Thr)-(Val)-(N-Me-Leu)-(Val)-(N-Me-Val)-(N-Me-4-OMe-Trp)-(Val)-(Ph-threo-Ser)-(Val) | Free | Free | N-methylation pattern, N-Me-Val = N-methyl-valine, N,N-Me2-Val = N,N-dimethyl-valine, N-Me-Thr = N-methyl-threonine, N-Me-Leu = N-methyl-leucine, N-Me-allo-Ilu = N-methyl-isoleucine, N-Me-4-OMe-Trp = N-methyl-4-methoxy-tryptophan, Ph-threo-Ser = Phe | Macrocyclic | 13 | L | NA | Natural | Produced by a genetically distinct Nonomuraea species, strain MJM5123. | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv strains with monoresistance to rifampin (RMP) (ATCC 35838) | MIC = 0.19 μM | In vitro | None | NA | NA | None | None | NA | Ecumicin markedly enhanced the ATPase activity of wild-type (WT) ClpC1 but prevented activation of proteolysis by ClpC1. so toxic proteins which are normally degraded by the ClpC1P1P2 complex, accumulate in the presence of ecumicin | ClpC1 ATPase complex | None | NA | 2015 | 25421483 |
antitb_1009 | Ecumicin | (N,N-Me2-Val)-(Val)-(N-Me-allo-Ilu)-(Thr)-(N-Me-Thr)-(Val)-(N-Me-Leu)-(Val)-(N-Me-Val)-(N-Me-4-OMe-Trp)-(Val)-(Ph-threo-Ser)-(Val) | Free | Free | N-methylation pattern, N-Me-Val = N-methyl-valine, N,N-Me2-Val = N,N-dimethyl-valine, N-Me-Thr = N-methyl-threonine, N-Me-Leu = N-methyl-leucine, N-Me-allo-Ilu = N-methyl-isoleucine, N-Me-4-OMe-Trp = N-methyl-4-methoxy-tryptophan, Ph-threo-Ser = Phe | Macrocyclic | 13 | L | NA | Natural | Produced by a genetically distinct Nonomuraea species, strain MJM5123. | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv strains with monoresistance to streptomycin (SM) (ATCC 35820), | MIC <0.12 μM | In vitro | None | NA | NA | None | None | NA | Ecumicin markedly enhanced the ATPase activity of wild-type (WT) ClpC1 but prevented activation of proteolysis by ClpC1. so toxic proteins which are normally degraded by the ClpC1P1P2 complex, accumulate in the presence of ecumicin | ClpC1 ATPase complex | None | NA | 2015 | 25421483 |
antitb_1010 | Ecumicin | (N,N-Me2-Val)-(Val)-(N-Me-allo-Ilu)-(Thr)-(N-Me-Thr)-(Val)-(N-Me-Leu)-(Val)-(N-Me-Val)-(N-Me-4-OMe-Trp)-(Val)-(Ph-threo-Ser)-(Val) | Free | Free | N-methylation pattern, N-Me-Val = N-methyl-valine, N,N-Me2-Val = N,N-dimethyl-valine, N-Me-Thr = N-methyl-threonine, N-Me-Leu = N-methyl-leucine, N-Me-allo-Ilu = N-methyl-isoleucine, N-Me-4-OMe-Trp = N-methyl-4-methoxy-tryptophan, Ph-threo-Ser = Phe | Macrocyclic | 13 | L | NA | Natural | Produced by a genetically distinct Nonomuraea species, strain MJM5123. | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv strains with monoresistance to cycloserine (CS) (ATCC 35826) | MIC = <0.12 μM | In vitro | None | NA | NA | None | None | NA | Ecumicin markedly enhanced the ATPase activity of wild-type (WT) ClpC1 but prevented activation of proteolysis by ClpC1. so toxic proteins which are normally degraded by the ClpC1P1P2 complex, accumulate in the presence of ecumicin | ClpC1 ATPase complex | None | NA | 2015 | 25421483 |
antitb_1011 | Ecumicin | (N,N-Me2-Val)-(Val)-(N-Me-allo-Ilu)-(Thr)-(N-Me-Thr)-(Val)-(N-Me-Leu)-(Val)-(N-Me-Val)-(N-Me-4-OMe-Trp)-(Val)-(Ph-threo-Ser)-(Val) | Free | Free | N-methylation pattern, N-Me-Val = N-methyl-valine, N,N-Me2-Val = N,N-dimethyl-valine, N-Me-Thr = N-methyl-threonine, N-Me-Leu = N-methyl-leucine, N-Me-allo-Ilu = N-methyl-isoleucine, N-Me-4-OMe-Trp = N-methyl-4-methoxy-tryptophan, Ph-threo-Ser = Phe | Macrocyclic | 13 | L | NA | Natural | Produced by a genetically distinct Nonomuraea species, strain MJM5123. | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv strains with monoresistance to moxifloxacin (MFX) | MIC = 0.31 μM | In vitro | None | NA | NA | None | None | NA | Ecumicin markedly enhanced the ATPase activity of wild-type (WT) ClpC1 but prevented activation of proteolysis by ClpC1. so toxic proteins which are normally degraded by the ClpC1P1P2 complex, accumulate in the presence of ecumicin | ClpC1 ATPase complex | None | NA | 2015 | 25421483 |
antitb_1012 | Ecumicin | (N,N-Me2-Val)-(Val)-(N-Me-allo-Ilu)-(Thr)-(N-Me-Thr)-(Val)-(N-Me-Leu)-(Val)-(N-Me-Val)-(N-Me-4-OMe-Trp)-(Val)-(Ph-threo-Ser)-(Val) | Free | Free | N-methylation pattern, N-Me-Val = N-methyl-valine, N,N-Me2-Val = N,N-dimethyl-valine, N-Me-Thr = N-methyl-threonine, N-Me-Leu = N-methyl-leucine, N-Me-allo-Ilu = N-methyl-isoleucine, N-Me-4-OMe-Trp = N-methyl-4-methoxy-tryptophan, Ph-threo-Ser = Phe | Macrocyclic | 13 | L | NA | Natural | Produced by a genetically distinct Nonomuraea species, strain MJM5123. | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv strains with monoresistance to capreomycin (CAP) | MIC = 0.29 μM | In vitro | None | NA | NA | None | None | NA | Ecumicin markedly enhanced the ATPase activity of wild-type (WT) ClpC1 but prevented activation of proteolysis by ClpC1. so toxic proteins which are normally degraded by the ClpC1P1P2 complex, accumulate in the presence of ecumicin | ClpC1 ATPase complex | None | NA | 2015 | 25421483 |
antitb_1013 | Ecumicin | (N,N-Me2-Val)-(Val)-(N-Me-allo-Ilu)-(Thr)-(N-Me-Thr)-(Val)-(N-Me-Leu)-(Val)-(N-Me-Val)-(N-Me-4-OMe-Trp)-(Val)-(Ph-threo-Ser)-(Val) | Free | Free | N-methylation pattern, N-Me-Val = N-methyl-valine, N,N-Me2-Val = N,N-dimethyl-valine, N-Me-Thr = N-methyl-threonine, N-Me-Leu = N-methyl-leucine, N-Me-allo-Ilu = N-methyl-isoleucine, N-Me-4-OMe-Trp = N-methyl-4-methoxy-tryptophan, Ph-threo-Ser = Phe | Macrocyclic | 13 | L | NA | Natural | Produced by a genetically distinct Nonomuraea species, strain MJM5123. | Mycobacterium smegmatis | Mycobacterium smegmatis (ATCC 700084) | MIC = 1.7 μM | In vitro | None | NA | NA | None | None | NA | Ecumicin markedly enhanced the ATPase activity of wild-type (WT) ClpC1 but prevented activation of proteolysis by ClpC1. so toxic proteins which are normally degraded by the ClpC1P1P2 complex, accumulate in the presence of ecumicin | ClpC1 ATPase complex | None | NA | 2015 | 25421483 |
antitb_1014 | Ecumicin | (N,N-Me2-Val)-(Val)-(N-Me-allo-Ilu)-(Thr)-(N-Me-Thr)-(Val)-(N-Me-Leu)-(Val)-(N-Me-Val)-(N-Me-4-OMe-Trp)-(Val)-(Ph-threo-Ser)-(Val) | Free | Free | N-methylation pattern, N-Me-Val = N-methyl-valine, N,N-Me2-Val = N,N-dimethyl-valine, N-Me-Thr = N-methyl-threonine, N-Me-Leu = N-methyl-leucine, N-Me-allo-Ilu = N-methyl-isoleucine, N-Me-4-OMe-Trp = N-methyl-4-methoxy-tryptophan, Ph-threo-Ser = Phe | Macrocyclic | 13 | L | NA | Natural | Produced by a genetically distinct Nonomuraea species, strain MJM5123. | Mycobacterium chelonae | Mycobacterium chelonae (ATCC 35752) | MIC = 0.97 μM | In vitro | None | NA | NA | None | None | NA | Ecumicin markedly enhanced the ATPase activity of wild-type (WT) ClpC1 but prevented activation of proteolysis by ClpC1. so toxic proteins which are normally degraded by the ClpC1P1P2 complex, accumulate in the presence of ecumicin | ClpC1 ATPase complex | None | NA | 2015 | 25421483 |
antitb_1015 | Ecumicin | (N,N-Me2-Val)-(Val)-(N-Me-allo-Ilu)-(Thr)-(N-Me-Thr)-(Val)-(N-Me-Leu)-(Val)-(N-Me-Val)-(N-Me-4-OMe-Trp)-(Val)-(Ph-threo-Ser)-(Val) | Free | Free | N-methylation pattern, N-Me-Val = N-methyl-valine, N,N-Me2-Val = N,N-dimethyl-valine, N-Me-Thr = N-methyl-threonine, N-Me-Leu = N-methyl-leucine, N-Me-allo-Ilu = N-methyl-isoleucine, N-Me-4-OMe-Trp = N-methyl-4-methoxy-tryptophan, Ph-threo-Ser = Phe | Macrocyclic | 13 | L | NA | Natural | Produced by a genetically distinct Nonomuraea species, strain MJM5123. | Mycobacterium marinum | Mycobacterium marinum (ATCC 927) | MIC = 0.95 μM | In vitro | None | NA | NA | None | None | NA | Ecumicin markedly enhanced the ATPase activity of wild-type (WT) ClpC1 but prevented activation of proteolysis by ClpC1. so toxic proteins which are normally degraded by the ClpC1P1P2 complex, accumulate in the presence of ecumicin | ClpC1 ATPase complex | None | NA | 2015 | 25421483 |
antitb_1016 | Ecumicin | (N,N-Me2-Val)-(Val)-(N-Me-allo-Ilu)-(Thr)-(N-Me-Thr)-(Val)-(N-Me-Leu)-(Val)-(N-Me-Val)-(N-Me-4-OMe-Trp)-(Val)-(Ph-threo-Ser)-(Val) | Free | Free | N-methylation pattern, N-Me-Val = N-methyl-valine, N,N-Me2-Val = N,N-dimethyl-valine, N-Me-Thr = N-methyl-threonine, N-Me-Leu = N-methyl-leucine, N-Me-allo-Ilu = N-methyl-isoleucine, N-Me-4-OMe-Trp = N-methyl-4-methoxy-tryptophan, Ph-threo-Ser = Phe | Macrocyclic | 13 | L | NA | Natural | Produced by a genetically distinct Nonomuraea species, strain MJM5123. | Mycobacterium abscessus | Mycobacterium abscessus (ATCC 19977) | MIC >63 μM | In vitro | None | NA | NA | None | None | NA | Ecumicin markedly enhanced the ATPase activity of wild-type (WT) ClpC1 but prevented activation of proteolysis by ClpC1. so toxic proteins which are normally degraded by the ClpC1P1P2 complex, accumulate in the presence of ecumicin | ClpC1 ATPase complex | None | NA | 2015 | 25421483 |
antitb_1017 | Ecumicin | (N,N-Me2-Val)-(Val)-(N-Me-allo-Ilu)-(Thr)-(N-Me-Thr)-(Val)-(N-Me-Leu)-(Val)-(N-Me-Val)-(N-Me-4-OMe-Trp)-(Val)-(Ph-threo-Ser)-(Val) | Free | Free | N-methylation pattern, N-Me-Val = N-methyl-valine, N,N-Me2-Val = N,N-dimethyl-valine, N-Me-Thr = N-methyl-threonine, N-Me-Leu = N-methyl-leucine, N-Me-allo-Ilu = N-methyl-isoleucine, N-Me-4-OMe-Trp = N-methyl-4-methoxy-tryptophan, Ph-threo-Ser = Phe | Macrocyclic | 13 | L | NA | Natural | Produced by a genetically distinct Nonomuraea species, strain MJM5123. | Mycobacterium avium | Mycobacterium avium (ATCC 15769) | MIC = 0.35 μM | In vitro | None | NA | NA | None | None | NA | Ecumicin markedly enhanced the ATPase activity of wild-type (WT) ClpC1 but prevented activation of proteolysis by ClpC1. so toxic proteins which are normally degraded by the ClpC1P1P2 complex, accumulate in the presence of ecumicin | ClpC1 ATPase complex | None | NA | 2015 | 25421483 |
antitb_1018 | Ecumicin | (N,N-Me2-Val)-(Val)-(N-Me-allo-Ilu)-(Thr)-(N-Me-Thr)-(Val)-(N-Me-Leu)-(Val)-(N-Me-Val)-(N-Me-4-OMe-Trp)-(Val)-(Ph-threo-Ser)-(Val) | Free | Free | N-methylation pattern, N-Me-Val = N-methyl-valine, N,N-Me2-Val = N,N-dimethyl-valine, N-Me-Thr = N-methyl-threonine, N-Me-Leu = N-methyl-leucine, N-Me-allo-Ilu = N-methyl-isoleucine, N-Me-4-OMe-Trp = N-methyl-4-methoxy-tryptophan, Ph-threo-Ser = Phe | Macrocyclic | 13 | L | NA | Natural | Produced by a genetically distinct Nonomuraea species, strain MJM5123. | Mycobacterium kansasii | Mycobacterium kansasii (ATCC 12478) | MIC = <0.24 μM | In vitro | None | NA | NA | None | None | NA | Ecumicin markedly enhanced the ATPase activity of wild-type (WT) ClpC1 but prevented activation of proteolysis by ClpC1. so toxic proteins which are normally degraded by the ClpC1P1P2 complex, accumulate in the presence of ecumicin | ClpC1 ATPase complex | None | NA | 2015 | 25421483 |
antitb_1019 | Ecumicin | (N,N-Me2-Val)-(Val)-(N-Me-allo-Ilu)-(Thr)-(N-Me-Thr)-(Val)-(N-Me-Leu)-(Val)-(N-Me-Val)-(N-Me-4-OMe-Trp)-(Val)-(Ph-threo-Ser)-(Val) | Free | Free | N-methylation pattern, N-Me-Val = N-methyl-valine, N,N-Me2-Val = N,N-dimethyl-valine, N-Me-Thr = N-methyl-threonine, N-Me-Leu = N-methyl-leucine, N-Me-allo-Ilu = N-methyl-isoleucine, N-Me-4-OMe-Trp = N-methyl-4-methoxy-tryptophan, Ph-threo-Ser = Phe | Macrocyclic | 13 | L | NA | Natural | Produced by a genetically distinct Nonomuraea species, strain MJM5123. | Mycobacterium tuberculosis | Mycobaterium tuberculosis MDR | MIC = 0.31 μM | In vitro | None | NA | NA | None | None | NA | Ecumicin markedly enhanced the ATPase activity of wild-type (WT) ClpC1 but prevented activation of proteolysis by ClpC1. so toxic proteins which are normally degraded by the ClpC1P1P2 complex, accumulate in the presence of ecumicin | ClpC1 ATPase complex | None | NA | 2015 | 25421483 |
antitb_1020 | Ecumicin | (N,N-Me2-Val)-(Val)-(N-Me-allo-Ilu)-(Thr)-(N-Me-Thr)-(Val)-(N-Me-Leu)-(Val)-(N-Me-Val)-(N-Me-4-OMe-Trp)-(Val)-(Ph-threo-Ser)-(Val) | Free | Free | N-methylation pattern, N-Me-Val = N-methyl-valine, N,N-Me2-Val = N,N-dimethyl-valine, N-Me-Thr = N-methyl-threonine, N-Me-Leu = N-methyl-leucine, N-Me-allo-Ilu = N-methyl-isoleucine, N-Me-4-OMe-Trp = N-methyl-4-methoxy-tryptophan, Ph-threo-Ser = Phe | Macrocyclic | 13 | L | NA | Natural | Produced by a genetically distinct Nonomuraea species, strain MJM5123. | Mycobacterium tuberculosis | Mycobaterium tuberculosis XDR | MIC = 0.31–0.62 μM | In vitro | None | NA | NA | None | None | NA | Ecumicin markedly enhanced the ATPase activity of wild-type (WT) ClpC1 but prevented activation of proteolysis by ClpC1. so toxic proteins which are normally degraded by the ClpC1P1P2 complex, accumulate in the presence of ecumicin | ClpC1 ATPase complex | None | NA | 2015 | 25421483 |
antitb_1021 | Ecumicin | (N,N-Me2-Val)-(Val)-(N-Me-allo-Ilu)-(Thr)-(N-Me-Thr)-(Val)-(N-Me-Leu)-(Val)-(N-Me-Val)-(N-Me-4-OMe-Trp)-(Val)-(Ph-threo-Ser)-(Val) | Free | Free | N-methylation pattern, N-Me-Val = N-methyl-valine, N,N-Me2-Val = N,N-dimethyl-valine, N-Me-Thr = N-methyl-threonine, N-Me-Leu = N-methyl-leucine, N-Me-allo-Ilu = N-methyl-isoleucine, N-Me-4-OMe-Trp = N-methyl-4-methoxy-tryptophan, Ph-threo-Ser = Phe | Macrocyclic | 13 | L | NA | Natural | Produced by a genetically distinct Nonomuraea species, strain MJM5123. | Mycobacterium tuberculosis | Single nucleotide polymorphism (SNP) clusters: X001354 corresponding to the Indo-Oceanic lineage, | MIC = 0.13–0.38 μM | In vitro | None | NA | NA | None | None | NA | Ecumicin markedly enhanced the ATPase activity of wild-type (WT) ClpC1 but prevented activation of proteolysis by ClpC1. so toxic proteins which are normally degraded by the ClpC1P1P2 complex, accumulate in the presence of ecumicin | ClpC1 ATPase complex | None | NA | 2015 | 25421483 |
antitb_1022 | Ecumicin | (N,N-Me2-Val)-(Val)-(N-Me-allo-Ilu)-(Thr)-(N-Me-Thr)-(Val)-(N-Me-Leu)-(Val)-(N-Me-Val)-(N-Me-4-OMe-Trp)-(Val)-(Ph-threo-Ser)-(Val) | Free | Free | N-methylation pattern, N-Me-Val = N-methyl-valine, N,N-Me2-Val = N,N-dimethyl-valine, N-Me-Thr = N-methyl-threonine, N-Me-Leu = N-methyl-leucine, N-Me-allo-Ilu = N-methyl-isoleucine, N-Me-4-OMe-Trp = N-methyl-4-methoxy-tryptophan, Ph-threo-Ser = Phe | Macrocyclic | 13 | L | NA | Natural | Produced by a genetically distinct Nonomuraea species, strain MJM5123. | Mycobacterium tuberculosis | Single nucleotide polymorphism (SNP) clusters: X004439 and X004244 to the East Asian lineage | MIC = 0.13–0.38 μM | In vitro | None | NA | NA | None | None | NA | Ecumicin markedly enhanced the ATPase activity of wild-type (WT) ClpC1 but prevented activation of proteolysis by ClpC1. so toxic proteins which are normally degraded by the ClpC1P1P2 complex, accumulate in the presence of ecumicin | ClpC1 ATPase complex | None | NA | 2015 | 25421483 |
antitb_1023 | Ecumicin | (N,N-Me2-Val)-(Val)-(N-Me-allo-Ilu)-(Thr)-(N-Me-Thr)-(Val)-(N-Me-Leu)-(Val)-(N-Me-Val)-(N-Me-4-OMe-Trp)-(Val)-(Ph-threo-Ser)-(Val) | Free | Free | N-methylation pattern, N-Me-Val = N-methyl-valine, N,N-Me2-Val = N,N-dimethyl-valine, N-Me-Thr = N-methyl-threonine, N-Me-Leu = N-methyl-leucine, N-Me-allo-Ilu = N-methyl-isoleucine, N-Me-4-OMe-Trp = N-methyl-4-methoxy-tryptophan, Ph-threo-Ser = Phe | Macrocyclic | 13 | L | NA | Natural | Produced by a genetically distinct Nonomuraea species, strain MJM5123. | Mycobacterium tuberculosis | Single nucleotide polymorphism (SNP) clusters: X005282 and X005319 to the Euro-American lineage | MIC = 0.13–0.38 μM | In vitro | None | NA | NA | None | None | NA | Ecumicin markedly enhanced the ATPase activity of wild-type (WT) ClpC1 but prevented activation of proteolysis by ClpC1. so toxic proteins which are normally degraded by the ClpC1P1P2 complex, accumulate in the presence of ecumicin | ClpC1 ATPase complex | None | NA | 2015 | 25421483 |
antitb_1024 | Ecumicin | (N,N-Me2-Val)-(Val)-(N-Me-allo-Ilu)-(Thr)-(N-Me-Thr)-(Val)-(N-Me-Leu)-(Val)-(N-Me-Val)-(N-Me-4-OMe-Trp)-(Val)-(Ph-threo-Ser)-(Val) | Free | Free | N-methylation pattern, N-Me-Val = N-methyl-valine, N,N-Me2-Val = N,N-dimethyl-valine, N-Me-Thr = N-methyl-threonine, N-Me-Leu = N-methyl-leucine, N-Me-allo-Ilu = N-methyl-isoleucine, N-Me-4-OMe-Trp = N-methyl-4-methoxy-tryptophan, Ph-threo-Ser = Phe | Macrocyclic | 13 | L | NA | Natural | Produced by a genetically distinct Nonomuraea species, strain MJM5123. | Mycobacterium tuberculosis | Single nucleotide polymorphism (SNP) clusters: X001354 to the East African Indian lineage | MIC = 0.13–0.38 μM | In vitro | None | NA | NA | None | None | NA | Ecumicin markedly enhanced the ATPase activity of wild-type (WT) ClpC1 but prevented activation of proteolysis by ClpC1. so toxic proteins which are normally degraded by the ClpC1P1P2 complex, accumulate in the presence of ecumicin | ClpC1 ATPase complex | None | NA | 2015 | 25421483 |
antitb_1132 | Human neutrophil defensin (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Internal disulphide bond (cys2-cys30, cys4-cys19,cys9-cys29) | Cyclic | 30 | L | Cationic | Protein Derived | From the human defensin protein found in granules of neutrophils. | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv (ATCC 25618) | 50 mg/L causes approx 70 % growth inhibition | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
antitb_1133 | Human neutrophil defensin (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Internal disulphide bond (cys2-cys30, cys4-cys19,cys9-cys29) | Cyclic | 30 | L | Cationic | Protein Derived | From the human defensin protein found in granules of neutrophils. | Mycobacterium tuberculosis | Mycobacterium tuberculosis E1380/94 MDR (Isoniazid, rifampicin, streptomycin, ethambutol) strain | 50 mg/L causes approx 30 % growth inhibition | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
antitb_1134 | Protegrin-1 (PG-1) | RGGRLCYCRRRFCVCVGR | Free | Free | Internal disulphide bond (between Cys 6-15 and Cys 8-13) | Cyclic | 18 | L | Cationic | Natural | Isolated from porcine leukocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv (ATCC 25618) | 50 mg/L causes approx 65 % growth inhibition | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
antitb_1135 | Protegrin-1 (PG-1) | RGGRLCYCRRRFCVCVGR | Free | Free | Internal disulphide bond (between Cys 6-15 and Cys 8-13) | Cyclic | 18 | L | Cationic | Natural | Isolated from porcine leukocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis E1380/94 MDR (Isoniazid, rifampicin, streptomycin, ethambutol) strain | 50 mg/L causes approx 39 % growth inhibition | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
antitb_1144 | Nisin A | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region due to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium smegmatis | Mycobacterium smegmatis mc2155 | NA | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1145 | Nisin A | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region due to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Ra | NA | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1146 | Nisin A | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region due to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium kansasii | Mycobacterium kansasii CIT11/06 | NA | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1147 | Nisin A | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region due to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium subsp. Hominissuis (CIT05/03) | NA | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1148 | Nisin A | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region due to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium paratuberculosis (ATCC 19698) | NA | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1149 | Nisin V | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANVK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium smegmatis | Mycobacterium smegmatis MC2155 | 2.2 mm zone of activity as compared to Nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1150 | Nisin V | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANVK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Ra | 10% decrease in relative growth as compared to Nicin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1151 | Nisin V | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANVK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium kansasii | Mycobacterium kansasii CIT11/06 | 20% decrease in relative growth as compared to Nicin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1152 | Nisin V | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANVK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium subsp. Hominissuis (CIT05/03) | 16% decrease in relative growth as compared to Nicin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1153 | Nisin V | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANVK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium paratuberculosis (ATCC 19698) | 23% decrease in relative growth as compared to Nicin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1154 | Nisin S | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMS-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium smegmatis | Mycobacterium smegmatis MC2155 | 4 mm zone of activity as compared to Nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1155 | Nisin S | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMS-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Ra | 26% reductions in growth, relative to that brought about by nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1156 | Nisin S | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMS-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium kansasii | Mycobacterium kansasii CIT11/06 | Relative growth was reduced by 29% compared to that which occurred in the presence of nisin A. | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1157 | Nisin S | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMS-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium subsp. Hominissuis (CIT05/03) | 28% reductions in growth, relative to that brought about by nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1158 | Nisin S | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMS-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium paratuberculosis (ATCC 19698) | 19% decrease in growth as compare to the presence of Nicin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1159 | Nisin T | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMT-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium smegmatis | Mycobacterium smegmatis MC2155 | 2.7 mm zone of activity as compared to Nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1160 | Nisin T | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMT-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Ra | 24% more inhibition as compared to nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1161 | Nisin T | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMT-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium kansasii | Mycobacterium kansasii CIT11/06 | 24% more inhibition as compared to nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1162 | Nisin T | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMT-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium subsp. Hominissuis (CIT05/03) | 16% more inhibition as compared to nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1163 | Nisin T | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMT-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium paratuberculosis (ATCC 19698) | 27% decrease in growth relative to nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1201 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 0.78–1.56 μg/ml or 0.41–0.83 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
antitb_1202 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis susceptible 186 clinical isolate | MIC = 1.56 μg/ml or 0.83 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
antitb_1203 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium tuberculosis | Mycobacterium tuberculosis susceptible 83 clinical isolate | MIC = 1.56-3.1 μg/ml or 0.83 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |