Detailed description page of THPdb

This page displays user query in tabular form.

Th1155 details

Primary information
ID 1663
ThPP ID Th1155
Therapeutic Peptide/Protein Name Urokinase
Sequence KPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSV view full sequnce in fasta
Functional Classification Ib
Molecular Weight 31126.5
Chemical Formula C1376H2145N383O406S18
Isoelectric Point 8.66
Hydrophobicity -0.466
Melting Point (℃) 76
Half Life 12 minutes
Description Low molecular weight form of human urokinase, that consists of an A chain of 2,000 daltons linked by a sulfhydryl bond to a B chain of 30,400 daltons. Recombinant urokinase plasminogen activator
Indication/Disease Urokinase can be used for the treatment of pulminary embolism, coronary artery thrombosis, IV catheter clearance, and venous and arterial blood clots.
Pharmacodynamics Urokinase is used for the treatment of pulmonary embolisms. The low molecular weight form of human urokinase consists of an A chain of 2,000 daltons linked by a sulfhydryl bond to a B chain of 30,400 daltons. Urokinase is an enzyme (protein) produced by the kidney, and found in the urine. There are two forms of urokinase which differ in molecular weight but have similar clinical effects. Urokinase is the low molecular weight form. Urokinase acts on the endogenous fibrinolytic system. It converts plasminogen to the enzyme plasmin. Plasmin degrades fibrin clots as well as fibrinogen and some other plasma proteins.
Mechanism of Action Urokinase acts on the endogenous fibrinolytic system. It cleaves the Arg-Val bond in plasminogen to produce active plasmin. Plasmin degrades fibrin clots as well as fibrinogen and other plasma proteins.
Toxicity Urokinase administered by intravenous infusion is rapidly cleared by the liver. Small fractions of the administered dose are excreted in bile and urine
Metabolism Proteolysis
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number US4258030
Date of Issue 07/03/81
Date of Expiry N.A.
Drug Interaction Drotrecogin alfa, Gingko biloba, Ginseng increases risk of bleeding.
Target Plasminogen,Urokinase plasminogen activator surface receptor, Urokinase-type plasminogen activator, Tissue-type plasminogen activator, Plasminogen activator inhibitor 1, 2, Plasma serine protease inhibitor, Low-density lipoprotein receptor-related protein 2, Suppressor of tumorigenicity 14 protein, Nidogen-1
Information of corresponding available drug in the market
Brand Name Kinlytic
Company N.A.
Brand Discription Kinlytic (urokinase for injection) is a thrombolytic agent obtained from human neonatal kidney cells grown in tissue culture. The principal active ingredient of Kinlytic is the low molecular weight form of urokinase, and consists of an A chain of 2,000 daltons linked by a sulfhydryl bond to a B chain of 30,400 daltons.
Prescribed for For the lysis of acute massive pulmonary emboli, defined as obstruction of blood flow to a lobe or multiple segments; For the lysis of pulmonary emboli accompanied by unstable hemodynamics, i.e., failure to maintain blood pressure without supportive measures.
Chemical Name N.A.
Formulation Each mL contains 50,000 international units of urokinase activity, 0.5% mannitol, 5% Albumin (Human), and 1% sodium chloride (pH range 6.0 to 7.5).
Physcial Appearance Kinlytic (urokinase injection) is supplied as a sterile lyophilized white powder
Route of Administration Intravenous infusion
Recommended Dosage The loading dose of 4,400 international units per kilogram of Kinlyticâ„¢ (urokinase injection) is given at a rate of 90 mL per hour over a period of 10 minutes.
Contraindication The use of Kinlytic (urokinase injection) is contraindicated in patients with a history of hypersensitivity to the product. It is also containdicated in stages like active internal bleeding, cardiopulmonary resustication, intracranial surgery.
Side Effects hypoxia, cyanosis, dyspnea, tachycardia, hypotension, hypertension, acidosis, fever and/or chills/rigors, back pain, vomiting, and nausea.
Useful Link http://www.drugs.com/mtm/urokinase.html; http://www.rxlist.com/kinlytic-drug.htm
PubMed ID 26876783, 25231010, 24140055, 23482705, 22817872, 20420509, 18030361, 15112999, 25460592
3-D Structure Th1155 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

Primary information
ID	1663
ThPP ID	Th1155
Therapeutic Peptide/Protein Name	Urokinase
Sequence	KPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSV view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	31126.5
Chemical Formula	C1376H2145N383O406S18
Isoelectric Point	8.66
Hydrophobicity	-0.466
Melting Point (℃)	76
Half Life	12 minutes
Description	Low molecular weight form of human urokinase, that consists of an A chain of 2,000 daltons linked by a sulfhydryl bond to a B chain of 30,400 daltons. Recombinant urokinase plasminogen activator
Indication/Disease	Urokinase can be used for the treatment of pulminary embolism, coronary artery thrombosis, IV catheter clearance, and venous and arterial blood clots.
Pharmacodynamics	Urokinase is used for the treatment of pulmonary embolisms. The low molecular weight form of human urokinase consists of an A chain of 2,000 daltons linked by a sulfhydryl bond to a B chain of 30,400 daltons. Urokinase is an enzyme (protein) produced by the kidney, and found in the urine. There are two forms of urokinase which differ in molecular weight but have similar clinical effects. Urokinase is the low molecular weight form. Urokinase acts on the endogenous fibrinolytic system. It converts plasminogen to the enzyme plasmin. Plasmin degrades fibrin clots as well as fibrinogen and some other plasma proteins.
Mechanism of Action	Urokinase acts on the endogenous fibrinolytic system. It cleaves the Arg-Val bond in plasminogen to produce active plasmin. Plasmin degrades fibrin clots as well as fibrinogen and other plasma proteins.
Toxicity	Urokinase administered by intravenous infusion is rapidly cleared by the liver. Small fractions of the administered dose are excreted in bile and urine
Metabolism	Proteolysis
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	US4258030
Date of Issue	07/03/81
Date of Expiry	N.A.
Drug Interaction	Drotrecogin alfa, Gingko biloba, Ginseng increases risk of bleeding.
Target	Plasminogen,Urokinase plasminogen activator surface receptor, Urokinase-type plasminogen activator, Tissue-type plasminogen activator, Plasminogen activator inhibitor 1, 2, Plasma serine protease inhibitor, Low-density lipoprotein receptor-related protein 2, Suppressor of tumorigenicity 14 protein, Nidogen-1
Information of corresponding available drug in the market
Brand Name	Kinlytic
Company	N.A.
Brand Discription	Kinlytic (urokinase for injection) is a thrombolytic agent obtained from human neonatal kidney cells grown in tissue culture. The principal active ingredient of Kinlytic is the low molecular weight form of urokinase, and consists of an A chain of 2,000 daltons linked by a sulfhydryl bond to a B chain of 30,400 daltons.
Prescribed for	For the lysis of acute massive pulmonary emboli, defined as obstruction of blood flow to a lobe or multiple segments; For the lysis of pulmonary emboli accompanied by unstable hemodynamics, i.e., failure to maintain blood pressure without supportive measures.
Chemical Name	N.A.
Formulation	Each mL contains 50,000 international units of urokinase activity, 0.5% mannitol, 5% Albumin (Human), and 1% sodium chloride (pH range 6.0 to 7.5).
Physcial Appearance	Kinlytic (urokinase injection) is supplied as a sterile lyophilized white powder
Route of Administration	Intravenous infusion
Recommended Dosage	The loading dose of 4,400 international units per kilogram of Kinlyticâ„¢ (urokinase injection) is given at a rate of 90 mL per hour over a period of 10 minutes.
Contraindication	The use of Kinlytic (urokinase injection) is contraindicated in patients with a history of hypersensitivity to the product. It is also containdicated in stages like active internal bleeding, cardiopulmonary resustication, intracranial surgery.
Side Effects	hypoxia, cyanosis, dyspnea, tachycardia, hypotension, hypertension, acidosis, fever and/or chills/rigors, back pain, vomiting, and nausea.
Useful Link	http://www.drugs.com/mtm/urokinase.html; http://www.rxlist.com/kinlytic-drug.htm
PubMed ID	26876783, 25231010, 24140055, 23482705, 22817872, 20420509, 18030361, 15112999, 25460592
3-D Structure	Th1155 (View) or (Download)