Detailed description page of THPdb

This page displays user query in tabular form.

Th1139 details

Primary information
ID 1628
ThPP ID Th1139
Therapeutic Peptide/Protein Name Certolizumab pegol
Sequence Light chain: DIQMTQSPSSLSASVGDRVTITCKASQNVGTNVAWYQ view full sequnce in fasta
Functional Classification IIb
Molecular Weight 91000
Chemical Formula C2115H3252N556O673S16
Isoelectric Point N.A.
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life Elimination half life- 14 days
Description Recombinant Fab' antibody fragment against TNF-alpha, which is conjugated to a ~40kDa Polyethylene glycol (PEG2MAL40K) moiety. PEG helps delay drug elimination. The light chain is made up of 214 amino acid residues while the heavy chain is composed of 229 amino acid residues. The molecular mass of the Fab' antibody fragment itself is 47.8 kDa (i.e. Excluding the PEG moiety). FDA approved on April 22, 2008.
Indication/Disease Reducing signs and symptoms of Crohn's disease and treatment of moderately to severely active rheumatoid arthritis (RA).
Pharmacodynamics TNFÎ± is a key pro-inflammatory cytokine with a central role in inflammatory processes. Biological activity associated to TNFÎ± include the upregulation of cellular adhesion molecules and chemokines, upregulation of major histocompatibility complex (MHC) class I and class II molecules, and direct leukocyte activation. TNFÎ± stimulates the production of downstream inflammatory mediators, including interleukin-1, prostaglandins, platelet activating factor, and nitric oxide. After treatment with certolizumab pegol, patients with Crohn's disease demonstrated a decrease in the levels of C-reactive protein (CRP).
Mechanism of Action N.A.
Toxicity The most common adverse reactions: upper respiratory tract infection, rash, and urinary tract infection.
Metabolism Metabolism has not been studied in humans.
Absorption There is a linear relationship between dose administered and Cmax and AUC. A mean Cmax of approximately 43 to 49 mcg/mL occurred at Week 5 during the initial loading dose period using the recommended dose regimen for the treatment of patients with rheumatoid arthritis (400 mg sc at Weeks 0, 2 and 4 followed by 200 mg every other week). Tmax, SubQ dose = 54 - 171 hours; Bioavailability, SubQ dose = 80% (range of 76% - 88%)
Volume of Distribution Vd, steady state, Crohn's and RA patients = 6 - 8 L
Clearance IV dose, healthy subjects = 9.21 mL/h to 14.38 mL/h;SC dose, Crohn's disease patients = 17 mL/h;SC dose, RA patients = 21.0 mL/h;
Categories TNF inhibitor
Patents Number CA2380298
Date of Issue 29/09/14
Date of Expiry 06/06/25
Drug Interaction N.A.
Target Tumor necrosis factor
Information of corresponding available drug in the market
Brand Name Cimzia
Company UCB
Brand Discription CIMZIA (certolizumab pegol) is a TNF blocker. CIMZIA is a recombinant, humanized antibody Fab' fragment, with specificity for human tumor necrosis factor alpha (TNFÎ±), conjugated to an approximately 40kDa polyethylene glycol (PEG2MAL40K). The Fab' fragment is manufactured in E. coli and is subsequently subjected to purification and conjugation to PEG2MAL40K, to generate certolizumab pegol. The Fab' fragment is composed of a light chain with 214 amino acids and a heavy chain with 229 amino acids. The molecular weight of certolizumab pegol is approximately 91 kiloDaltons
Prescribed for Crohn's Disease, Rheumatoid Arthritis, Psoriatic Arthritis
Chemical Name N.A.
Formulation Each single-use prefilled syringe of CIMZIA delivers 200 mg in 1 mL of solution with a pH of approximately 4.7 for subcutaneous use. Each 1 mL syringe of CIMZIA contains certolizumab pegol (200 mg), sodium acetate (1.36 mg), sodium chloride (7.31 mg), and Water for Injection, USP.
Physcial Appearance CIMZIA is supplied as either a sterile, white, lyophilized powder for solution or as a sterile, solution in a single-use prefilled 1 mL glass syringe for subcutaneous injection
Route of Administration Subcutaneous
Recommended Dosage 400 mg dose is needed (given as two subcutaneous injections of 200 mg), injections should occur at separate sites in the thigh or abdomen.
Contraindication N.A.
Side Effects Serious Infections, Malignancies, Heart Failure
Useful Link http://www.rxlist.com/cimzia-drug.htm http://www.cimzia.com/ http://www.drugs.com/cimzia.html
PubMed ID 25651776, 25645901, 25586216, 25555459, 23620660, 23451881
3-D Structure Th1139 light Chainor (Download)Th1139 Heavy Chain (View) or (Download)

Primary information
ID 1629
ThPP ID Th1139
Therapeutic Peptide/Protein Name Certolizumab pegol
Sequence Light chain: DIQMTQSPSSLSASVGDRVTITCKASQNVGTNVAWYQ view full sequnce in fasta
Functional Classification IIb
Molecular Weight 91000
Chemical Formula C2115H3252N556O673S16
Isoelectric Point N.A.
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life Elimination half life- 14 days
Description Recombinant Fab' antibody fragment against TNF-alpha, which is conjugated to a ~40kDa Polyethylene glycol (PEG2MAL40K) moiety. PEG helps delay drug elimination. The light chain is made up of 214 amino acid residues while the heavy chain is composed of 229 amino acid residues. The molecular mass of the Fab' antibody fragment itself is 47.8 kDa (i.e. Excluding the PEG moiety). FDA approved on April 22, 2008
Indication/Disease Reducing signs and symptoms of Crohn's disease and treatment of moderately to severely active rheumatoid arthritis (RA).
Pharmacodynamics TNFÎ± is a key pro-inflammatory cytokine with a central role in inflammatory processes. Biological activity associated to TNFÎ± include the upregulation of cellular adhesion molecules and chemokines, upregulation of major histocompatibility complex (MHC) class I and class II molecules, and direct leukocyte activation. TNFÎ± stimulates the production of downstream inflammatory mediators, including interleukin-1, prostaglandins, platelet activating factor, and nitric oxide. After treatment with certolizumab pegol, patients with Crohn's disease demonstrated a decrease in the levels of C-reactive protein (CRP).
Mechanism of Action N.A.
Toxicity The most common adverse reactions: upper respiratory tract infection, rash, and urinary tract infection.
Metabolism Metabolism has not been studied in humans.
Absorption There is a linear relationship between dose administered and Cmax and AUC. A mean Cmax of approximately 43 to 49 mcg/mL occurred at Week 5 during the initial loading dose period using the recommended dose regimen for the treatment of patients with rheumatoid arthritis (400 mg sc at Weeks 0, 2 and 4 followed by 200 mg every other week). Tmax, SubQ dose = 54 - 171 hours; Bioavailability, SubQ dose = 80% (range of 76% - 88%)
Volume of Distribution Vd, steady state, Crohn's and RA patients = 6 - 8 L
Clearance IV dose, healthy subjects = 9.21 mL/h to 14.38 mL/h;SC dose, Crohn's disease patients = 17 mL/h;SC dose, RA patients = 21.0 mL/h;
Categories TNF inhibitor
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 25651776, 25645901, 25586216, 25555459, 23620660, 23451881
3-D Structure Th1139 light Chainor (Download)Th1139 Heavy Chain (View) or (Download)

Primary information
ID 1630
ThPP ID Th1139
Therapeutic Peptide/Protein Name Certolizumab pegol
Sequence Light chain: DIQMTQSPSSLSASVGDRVTITCKASQNVGTNVAWYQ view full sequnce in fasta
Functional Classification IIb
Molecular Weight 91000
Chemical Formula C2115H3252N556O673S16
Isoelectric Point N.A.
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life Elimination half life- 14 days
Description Recombinant Fab' antibody fragment against TNF-alpha, which is conjugated to a ~40kDa Polyethylene glycol (PEG2MAL40K) moiety. PEG helps delay drug elimination. The light chain is made up of 214 amino acid residues while the heavy chain is composed of 229 amino acid residues. The molecular mass of the Fab' antibody fragment itself is 47.8 kDa (i.e. Excluding the PEG moiety). FDA approved on April 22, 2008
Indication/Disease Reducing signs and symptoms of Crohn's disease and treatment of moderately to severely active rheumatoid arthritis (RA).
Pharmacodynamics TNFÎ± is a key pro-inflammatory cytokine with a central role in inflammatory processes. Biological activity associated to TNFÎ± include the upregulation of cellular adhesion molecules and chemokines, upregulation of major histocompatibility complex (MHC) class I and class II molecules, and direct leukocyte activation. TNFÎ± stimulates the production of downstream inflammatory mediators, including interleukin-1, prostaglandins, platelet activating factor, and nitric oxide. After treatment with certolizumab pegol, patients with Crohn's disease demonstrated a decrease in the levels of C-reactive protein (CRP).
Mechanism of Action N.A.
Toxicity The most common adverse reactions: upper respiratory tract infection, rash, and urinary tract infection.
Metabolism Metabolism has not been studied in humans.
Absorption There is a linear relationship between dose administered and Cmax and AUC. A mean Cmax of approximately 43 to 49 mcg/mL occurred at Week 5 during the initial loading dose period using the recommended dose regimen for the treatment of patients with rheumatoid arthritis (400 mg sc at Weeks 0, 2 and 4 followed by 200 mg every other week). Tmax, SubQ dose = 54 - 171 hours; Bioavailability, SubQ dose = 80% (range of 76% - 88%)
Volume of Distribution Vd, steady state, Crohn's and RA patients = 6 - 8 L
Clearance IV dose, healthy subjects = 9.21 mL/h to 14.38 mL/h;SC dose, Crohn's disease patients = 17 mL/h;SC dose, RA patients = 21.0 mL/h;
Categories TNF inhibitor
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 25651776, 25645901, 25586216, 25555459, 23620660, 23451881
3-D Structure Th1139 light Chainor (Download)Th1139 Heavy Chain (View) or (Download)

Primary information
ID 1631
ThPP ID Th1139
Therapeutic Peptide/Protein Name Certolizumab pegol
Sequence Light chain: DIQMTQSPSSLSASVGDRVTITCKASQNVGTNVAWYQ view full sequnce in fasta
Functional Classification IIb
Molecular Weight 91000
Chemical Formula C2115H3252N556O673S16
Isoelectric Point N.A.
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life Elimination half life- 14 days
Description Recombinant Fab' antibody fragment against TNF-alpha, which is conjugated to a ~40kDa Polyethylene glycol (PEG2MAL40K) moiety. PEG helps delay drug elimination. The light chain is made up of 214 amino acid residues while the heavy chain is composed of 229 amino acid residues. The molecular mass of the Fab' antibody fragment itself is 47.8 kDa (i.e. Excluding the PEG moiety). FDA approved on April 22, 2008
Indication/Disease Reducing signs and symptoms of Crohn's disease and treatment of moderately to severely active rheumatoid arthritis (RA).
Pharmacodynamics TNFÎ± is a key pro-inflammatory cytokine with a central role in inflammatory processes. Biological activity associated to TNFÎ± include the upregulation of cellular adhesion molecules and chemokines, upregulation of major histocompatibility complex (MHC) class I and class II molecules, and direct leukocyte activation. TNFÎ± stimulates the production of downstream inflammatory mediators, including interleukin-1, prostaglandins, platelet activating factor, and nitric oxide. After treatment with certolizumab pegol, patients with Crohn's disease demonstrated a decrease in the levels of C-reactive protein (CRP).
Mechanism of Action N.A.
Toxicity The most common adverse reactions: upper respiratory tract infection, rash, and urinary tract infection.
Metabolism Metabolism has not been studied in humans.
Absorption There is a linear relationship between dose administered and Cmax and AUC. A mean Cmax of approximately 43 to 49 mcg/mL occurred at Week 5 during the initial loading dose period using the recommended dose regimen for the treatment of patients with rheumatoid arthritis (400 mg sc at Weeks 0, 2 and 4 followed by 200 mg every other week). Tmax, SubQ dose = 54 - 171 hours; Bioavailability, SubQ dose = 80% (range of 76% - 88%)
Volume of Distribution Vd, steady state, Crohn's and RA patients = 6 - 8 L
Clearance IV dose, healthy subjects = 9.21 mL/h to 14.38 mL/h;SC dose, Crohn's disease patients = 17 mL/h;SC dose, RA patients = 21.0 mL/h;
Categories TNF inhibitor
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 25651776, 25645901, 25586216, 25555459, 23620660, 23451881
3-D Structure Th1139 light Chainor (Download)Th1139 Heavy Chain (View) or (Download)

Primary information
ID 1632
ThPP ID Th1139
Therapeutic Peptide/Protein Name Certolizumab pegol
Sequence Light chain: DIQMTQSPSSLSASVGDRVTITCKASQNVGTNVAWYQ view full sequnce in fasta
Functional Classification IIb
Molecular Weight 91000
Chemical Formula C2115H3252N556O673S16
Isoelectric Point N.A.
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life Elimination half life- 14 days
Description Recombinant Fab' antibody fragment against TNF-alpha, which is conjugated to a ~40kDa Polyethylene glycol (PEG2MAL40K) moiety. PEG helps delay drug elimination. The light chain is made up of 214 amino acid residues while the heavy chain is composed of 229 amino acid residues. The molecular mass of the Fab' antibody fragment itself is 47.8 kDa (i.e. Excluding the PEG moiety). FDA approved on April 22, 2008
Indication/Disease Reducing signs and symptoms of Crohn's disease and treatment of moderately to severely active rheumatoid arthritis (RA).
Pharmacodynamics TNFÎ± is a key pro-inflammatory cytokine with a central role in inflammatory processes. Biological activity associated to TNFÎ± include the upregulation of cellular adhesion molecules and chemokines, upregulation of major histocompatibility complex (MHC) class I and class II molecules, and direct leukocyte activation. TNFÎ± stimulates the production of downstream inflammatory mediators, including interleukin-1, prostaglandins, platelet activating factor, and nitric oxide. After treatment with certolizumab pegol, patients with Crohn's disease demonstrated a decrease in the levels of C-reactive protein (CRP).
Mechanism of Action N.A.
Toxicity The most common adverse reactions: upper respiratory tract infection, rash, and urinary tract infection.
Metabolism Metabolism has not been studied in humans.
Absorption There is a linear relationship between dose administered and Cmax and AUC. A mean Cmax of approximately 43 to 49 mcg/mL occurred at Week 5 during the initial loading dose period using the recommended dose regimen for the treatment of patients with rheumatoid arthritis (400 mg sc at Weeks 0, 2 and 4 followed by 200 mg every other week). Tmax, SubQ dose = 54 - 171 hours; Bioavailability, SubQ dose = 80% (range of 76% - 88%)
Volume of Distribution Vd, steady state, Crohn's and RA patients = 6 - 8 L
Clearance IV dose, healthy subjects = 9.21 mL/h to 14.38 mL/h;SC dose, Crohn's disease patients = 17 mL/h;SC dose, RA patients = 21.0 mL/h;
Categories TNF inhibitor
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 25651776, 25645901, 25586216, 25555459, 23620660, 23451881
3-D Structure Th1139 light Chainor (Download)Th1139 Heavy Chain (View) or (Download)

Primary information
ID 1633
ThPP ID Th1139
Therapeutic Peptide/Protein Name Certolizumab pegol
Sequence Light chain: DIQMTQSPSSLSASVGDRVTITCKASQNVGTNVAWYQ view full sequnce in fasta
Functional Classification IIb
Molecular Weight 91000
Chemical Formula C2115H3252N556O673S16
Isoelectric Point N.A.
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life Elimination half life- 14 days
Description Recombinant Fab' antibody fragment against TNF-alpha, which is conjugated to a ~40kDa Polyethylene glycol (PEG2MAL40K) moiety. PEG helps delay drug elimination. The light chain is made up of 214 amino acid residues while the heavy chain is composed of 229 amino acid residues. The molecular mass of the Fab' antibody fragment itself is 47.8 kDa (i.e. Excluding the PEG moiety). FDA approved on April 22, 2008
Indication/Disease Reducing signs and symptoms of Crohn's disease and treatment of moderately to severely active rheumatoid arthritis (RA).
Pharmacodynamics TNFÎ± is a key pro-inflammatory cytokine with a central role in inflammatory processes. Biological activity associated to TNFÎ± include the upregulation of cellular adhesion molecules and chemokines, upregulation of major histocompatibility complex (MHC) class I and class II molecules, and direct leukocyte activation. TNFÎ± stimulates the production of downstream inflammatory mediators, including interleukin-1, prostaglandins, platelet activating factor, and nitric oxide. After treatment with certolizumab pegol, patients with Crohn's disease demonstrated a decrease in the levels of C-reactive protein (CRP).
Mechanism of Action N.A.
Toxicity The most common adverse reactions: upper respiratory tract infection, rash, and urinary tract infection.
Metabolism Metabolism has not been studied in humans.
Absorption There is a linear relationship between dose administered and Cmax and AUC. A mean Cmax of approximately 43 to 49 mcg/mL occurred at Week 5 during the initial loading dose period using the recommended dose regimen for the treatment of patients with rheumatoid arthritis (400 mg sc at Weeks 0, 2 and 4 followed by 200 mg every other week). Tmax, SubQ dose = 54 - 171 hours; Bioavailability, SubQ dose = 80% (range of 76% - 88%)
Volume of Distribution Vd, steady state, Crohn's and RA patients = 6 - 8 L
Clearance IV dose, healthy subjects = 9.21 mL/h to 14.38 mL/h;SC dose, Crohn's disease patients = 17 mL/h;SC dose, RA patients = 21.0 mL/h;
Categories TNF inhibitor
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 25651776, 25645901, 25586216, 25555459, 23620660, 23451881
3-D Structure Th1139 light Chainor (Download)Th1139 Heavy Chain (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

Primary information
ID	1628
ThPP ID	Th1139
Therapeutic Peptide/Protein Name	Certolizumab pegol
Sequence	Light chain: DIQMTQSPSSLSASVGDRVTITCKASQNVGTNVAWYQ view full sequnce in fasta
Functional Classification	IIb
Molecular Weight	91000
Chemical Formula	C2115H3252N556O673S16
Isoelectric Point	N.A.
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	Elimination half life- 14 days
Description	Recombinant Fab' antibody fragment against TNF-alpha, which is conjugated to a ~40kDa Polyethylene glycol (PEG2MAL40K) moiety. PEG helps delay drug elimination. The light chain is made up of 214 amino acid residues while the heavy chain is composed of 229 amino acid residues. The molecular mass of the Fab' antibody fragment itself is 47.8 kDa (i.e. Excluding the PEG moiety). FDA approved on April 22, 2008.
Indication/Disease	Reducing signs and symptoms of Crohn's disease and treatment of moderately to severely active rheumatoid arthritis (RA).
Pharmacodynamics	TNFÎ± is a key pro-inflammatory cytokine with a central role in inflammatory processes. Biological activity associated to TNFÎ± include the upregulation of cellular adhesion molecules and chemokines, upregulation of major histocompatibility complex (MHC) class I and class II molecules, and direct leukocyte activation. TNFÎ± stimulates the production of downstream inflammatory mediators, including interleukin-1, prostaglandins, platelet activating factor, and nitric oxide. After treatment with certolizumab pegol, patients with Crohn's disease demonstrated a decrease in the levels of C-reactive protein (CRP).
Mechanism of Action	N.A.
Toxicity	The most common adverse reactions: upper respiratory tract infection, rash, and urinary tract infection.
Metabolism	Metabolism has not been studied in humans.
Absorption	There is a linear relationship between dose administered and Cmax and AUC. A mean Cmax of approximately 43 to 49 mcg/mL occurred at Week 5 during the initial loading dose period using the recommended dose regimen for the treatment of patients with rheumatoid arthritis (400 mg sc at Weeks 0, 2 and 4 followed by 200 mg every other week). Tmax, SubQ dose = 54 - 171 hours; Bioavailability, SubQ dose = 80% (range of 76% - 88%)
Volume of Distribution	Vd, steady state, Crohn's and RA patients = 6 - 8 L
Clearance	IV dose, healthy subjects = 9.21 mL/h to 14.38 mL/h;SC dose, Crohn's disease patients = 17 mL/h;SC dose, RA patients = 21.0 mL/h;
Categories	TNF inhibitor
Patents Number	CA2380298
Date of Issue	29/09/14
Date of Expiry	06/06/25
Drug Interaction	N.A.
Target	Tumor necrosis factor
Information of corresponding available drug in the market
Brand Name	Cimzia
Company	UCB
Brand Discription	CIMZIA (certolizumab pegol) is a TNF blocker. CIMZIA is a recombinant, humanized antibody Fab' fragment, with specificity for human tumor necrosis factor alpha (TNFÎ±), conjugated to an approximately 40kDa polyethylene glycol (PEG2MAL40K). The Fab' fragment is manufactured in E. coli and is subsequently subjected to purification and conjugation to PEG2MAL40K, to generate certolizumab pegol. The Fab' fragment is composed of a light chain with 214 amino acids and a heavy chain with 229 amino acids. The molecular weight of certolizumab pegol is approximately 91 kiloDaltons
Prescribed for	Crohn's Disease, Rheumatoid Arthritis, Psoriatic Arthritis
Chemical Name	N.A.
Formulation	Each single-use prefilled syringe of CIMZIA delivers 200 mg in 1 mL of solution with a pH of approximately 4.7 for subcutaneous use. Each 1 mL syringe of CIMZIA contains certolizumab pegol (200 mg), sodium acetate (1.36 mg), sodium chloride (7.31 mg), and Water for Injection, USP.
Physcial Appearance	CIMZIA is supplied as either a sterile, white, lyophilized powder for solution or as a sterile, solution in a single-use prefilled 1 mL glass syringe for subcutaneous injection
Route of Administration	Subcutaneous
Recommended Dosage	400 mg dose is needed (given as two subcutaneous injections of 200 mg), injections should occur at separate sites in the thigh or abdomen.
Contraindication	N.A.
Side Effects	Serious Infections, Malignancies, Heart Failure
Useful Link	http://www.rxlist.com/cimzia-drug.htm http://www.cimzia.com/ http://www.drugs.com/cimzia.html
PubMed ID	25651776, 25645901, 25586216, 25555459, 23620660, 23451881
3-D Structure	Th1139 light Chainor (Download)Th1139 Heavy Chain (View) or (Download)

Primary information
ID	1629
ThPP ID	Th1139
Therapeutic Peptide/Protein Name	Certolizumab pegol
Sequence	Light chain: DIQMTQSPSSLSASVGDRVTITCKASQNVGTNVAWYQ view full sequnce in fasta
Functional Classification	IIb
Molecular Weight	91000
Chemical Formula	C2115H3252N556O673S16
Isoelectric Point	N.A.
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	Elimination half life- 14 days
Description	Recombinant Fab' antibody fragment against TNF-alpha, which is conjugated to a ~40kDa Polyethylene glycol (PEG2MAL40K) moiety. PEG helps delay drug elimination. The light chain is made up of 214 amino acid residues while the heavy chain is composed of 229 amino acid residues. The molecular mass of the Fab' antibody fragment itself is 47.8 kDa (i.e. Excluding the PEG moiety). FDA approved on April 22, 2008
Indication/Disease	Reducing signs and symptoms of Crohn's disease and treatment of moderately to severely active rheumatoid arthritis (RA).
Pharmacodynamics	TNFÎ± is a key pro-inflammatory cytokine with a central role in inflammatory processes. Biological activity associated to TNFÎ± include the upregulation of cellular adhesion molecules and chemokines, upregulation of major histocompatibility complex (MHC) class I and class II molecules, and direct leukocyte activation. TNFÎ± stimulates the production of downstream inflammatory mediators, including interleukin-1, prostaglandins, platelet activating factor, and nitric oxide. After treatment with certolizumab pegol, patients with Crohn's disease demonstrated a decrease in the levels of C-reactive protein (CRP).
Mechanism of Action	N.A.
Toxicity	The most common adverse reactions: upper respiratory tract infection, rash, and urinary tract infection.
Metabolism	Metabolism has not been studied in humans.
Absorption	There is a linear relationship between dose administered and Cmax and AUC. A mean Cmax of approximately 43 to 49 mcg/mL occurred at Week 5 during the initial loading dose period using the recommended dose regimen for the treatment of patients with rheumatoid arthritis (400 mg sc at Weeks 0, 2 and 4 followed by 200 mg every other week). Tmax, SubQ dose = 54 - 171 hours; Bioavailability, SubQ dose = 80% (range of 76% - 88%)
Volume of Distribution	Vd, steady state, Crohn's and RA patients = 6 - 8 L
Clearance	IV dose, healthy subjects = 9.21 mL/h to 14.38 mL/h;SC dose, Crohn's disease patients = 17 mL/h;SC dose, RA patients = 21.0 mL/h;
Categories	TNF inhibitor
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	25651776, 25645901, 25586216, 25555459, 23620660, 23451881
3-D Structure	Th1139 light Chainor (Download)Th1139 Heavy Chain (View) or (Download)

Primary information
ID	1630
ThPP ID	Th1139
Therapeutic Peptide/Protein Name	Certolizumab pegol
Sequence	Light chain: DIQMTQSPSSLSASVGDRVTITCKASQNVGTNVAWYQ view full sequnce in fasta
Functional Classification	IIb
Molecular Weight	91000
Chemical Formula	C2115H3252N556O673S16
Isoelectric Point	N.A.
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	Elimination half life- 14 days
Description	Recombinant Fab' antibody fragment against TNF-alpha, which is conjugated to a ~40kDa Polyethylene glycol (PEG2MAL40K) moiety. PEG helps delay drug elimination. The light chain is made up of 214 amino acid residues while the heavy chain is composed of 229 amino acid residues. The molecular mass of the Fab' antibody fragment itself is 47.8 kDa (i.e. Excluding the PEG moiety). FDA approved on April 22, 2008
Indication/Disease	Reducing signs and symptoms of Crohn's disease and treatment of moderately to severely active rheumatoid arthritis (RA).
Pharmacodynamics	TNFÎ± is a key pro-inflammatory cytokine with a central role in inflammatory processes. Biological activity associated to TNFÎ± include the upregulation of cellular adhesion molecules and chemokines, upregulation of major histocompatibility complex (MHC) class I and class II molecules, and direct leukocyte activation. TNFÎ± stimulates the production of downstream inflammatory mediators, including interleukin-1, prostaglandins, platelet activating factor, and nitric oxide. After treatment with certolizumab pegol, patients with Crohn's disease demonstrated a decrease in the levels of C-reactive protein (CRP).
Mechanism of Action	N.A.
Toxicity	The most common adverse reactions: upper respiratory tract infection, rash, and urinary tract infection.
Metabolism	Metabolism has not been studied in humans.
Absorption	There is a linear relationship between dose administered and Cmax and AUC. A mean Cmax of approximately 43 to 49 mcg/mL occurred at Week 5 during the initial loading dose period using the recommended dose regimen for the treatment of patients with rheumatoid arthritis (400 mg sc at Weeks 0, 2 and 4 followed by 200 mg every other week). Tmax, SubQ dose = 54 - 171 hours; Bioavailability, SubQ dose = 80% (range of 76% - 88%)
Volume of Distribution	Vd, steady state, Crohn's and RA patients = 6 - 8 L
Clearance	IV dose, healthy subjects = 9.21 mL/h to 14.38 mL/h;SC dose, Crohn's disease patients = 17 mL/h;SC dose, RA patients = 21.0 mL/h;
Categories	TNF inhibitor
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	25651776, 25645901, 25586216, 25555459, 23620660, 23451881
3-D Structure	Th1139 light Chainor (Download)Th1139 Heavy Chain (View) or (Download)

Primary information
ID	1631
ThPP ID	Th1139
Therapeutic Peptide/Protein Name	Certolizumab pegol
Sequence	Light chain: DIQMTQSPSSLSASVGDRVTITCKASQNVGTNVAWYQ view full sequnce in fasta
Functional Classification	IIb
Molecular Weight	91000
Chemical Formula	C2115H3252N556O673S16
Isoelectric Point	N.A.
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	Elimination half life- 14 days
Description	Recombinant Fab' antibody fragment against TNF-alpha, which is conjugated to a ~40kDa Polyethylene glycol (PEG2MAL40K) moiety. PEG helps delay drug elimination. The light chain is made up of 214 amino acid residues while the heavy chain is composed of 229 amino acid residues. The molecular mass of the Fab' antibody fragment itself is 47.8 kDa (i.e. Excluding the PEG moiety). FDA approved on April 22, 2008
Indication/Disease	Reducing signs and symptoms of Crohn's disease and treatment of moderately to severely active rheumatoid arthritis (RA).
Pharmacodynamics	TNFÎ± is a key pro-inflammatory cytokine with a central role in inflammatory processes. Biological activity associated to TNFÎ± include the upregulation of cellular adhesion molecules and chemokines, upregulation of major histocompatibility complex (MHC) class I and class II molecules, and direct leukocyte activation. TNFÎ± stimulates the production of downstream inflammatory mediators, including interleukin-1, prostaglandins, platelet activating factor, and nitric oxide. After treatment with certolizumab pegol, patients with Crohn's disease demonstrated a decrease in the levels of C-reactive protein (CRP).
Mechanism of Action	N.A.
Toxicity	The most common adverse reactions: upper respiratory tract infection, rash, and urinary tract infection.
Metabolism	Metabolism has not been studied in humans.
Absorption	There is a linear relationship between dose administered and Cmax and AUC. A mean Cmax of approximately 43 to 49 mcg/mL occurred at Week 5 during the initial loading dose period using the recommended dose regimen for the treatment of patients with rheumatoid arthritis (400 mg sc at Weeks 0, 2 and 4 followed by 200 mg every other week). Tmax, SubQ dose = 54 - 171 hours; Bioavailability, SubQ dose = 80% (range of 76% - 88%)
Volume of Distribution	Vd, steady state, Crohn's and RA patients = 6 - 8 L
Clearance	IV dose, healthy subjects = 9.21 mL/h to 14.38 mL/h;SC dose, Crohn's disease patients = 17 mL/h;SC dose, RA patients = 21.0 mL/h;
Categories	TNF inhibitor
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	25651776, 25645901, 25586216, 25555459, 23620660, 23451881
3-D Structure	Th1139 light Chainor (Download)Th1139 Heavy Chain (View) or (Download)

Primary information
ID	1632
ThPP ID	Th1139
Therapeutic Peptide/Protein Name	Certolizumab pegol
Sequence	Light chain: DIQMTQSPSSLSASVGDRVTITCKASQNVGTNVAWYQ view full sequnce in fasta
Functional Classification	IIb
Molecular Weight	91000
Chemical Formula	C2115H3252N556O673S16
Isoelectric Point	N.A.
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	Elimination half life- 14 days
Description	Recombinant Fab' antibody fragment against TNF-alpha, which is conjugated to a ~40kDa Polyethylene glycol (PEG2MAL40K) moiety. PEG helps delay drug elimination. The light chain is made up of 214 amino acid residues while the heavy chain is composed of 229 amino acid residues. The molecular mass of the Fab' antibody fragment itself is 47.8 kDa (i.e. Excluding the PEG moiety). FDA approved on April 22, 2008
Indication/Disease	Reducing signs and symptoms of Crohn's disease and treatment of moderately to severely active rheumatoid arthritis (RA).
Pharmacodynamics	TNFÎ± is a key pro-inflammatory cytokine with a central role in inflammatory processes. Biological activity associated to TNFÎ± include the upregulation of cellular adhesion molecules and chemokines, upregulation of major histocompatibility complex (MHC) class I and class II molecules, and direct leukocyte activation. TNFÎ± stimulates the production of downstream inflammatory mediators, including interleukin-1, prostaglandins, platelet activating factor, and nitric oxide. After treatment with certolizumab pegol, patients with Crohn's disease demonstrated a decrease in the levels of C-reactive protein (CRP).
Mechanism of Action	N.A.
Toxicity	The most common adverse reactions: upper respiratory tract infection, rash, and urinary tract infection.
Metabolism	Metabolism has not been studied in humans.
Absorption	There is a linear relationship between dose administered and Cmax and AUC. A mean Cmax of approximately 43 to 49 mcg/mL occurred at Week 5 during the initial loading dose period using the recommended dose regimen for the treatment of patients with rheumatoid arthritis (400 mg sc at Weeks 0, 2 and 4 followed by 200 mg every other week). Tmax, SubQ dose = 54 - 171 hours; Bioavailability, SubQ dose = 80% (range of 76% - 88%)
Volume of Distribution	Vd, steady state, Crohn's and RA patients = 6 - 8 L
Clearance	IV dose, healthy subjects = 9.21 mL/h to 14.38 mL/h;SC dose, Crohn's disease patients = 17 mL/h;SC dose, RA patients = 21.0 mL/h;
Categories	TNF inhibitor
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	25651776, 25645901, 25586216, 25555459, 23620660, 23451881
3-D Structure	Th1139 light Chainor (Download)Th1139 Heavy Chain (View) or (Download)

Primary information
ID	1633
ThPP ID	Th1139
Therapeutic Peptide/Protein Name	Certolizumab pegol
Sequence	Light chain: DIQMTQSPSSLSASVGDRVTITCKASQNVGTNVAWYQ view full sequnce in fasta
Functional Classification	IIb
Molecular Weight	91000
Chemical Formula	C2115H3252N556O673S16
Isoelectric Point	N.A.
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	Elimination half life- 14 days
Description	Recombinant Fab' antibody fragment against TNF-alpha, which is conjugated to a ~40kDa Polyethylene glycol (PEG2MAL40K) moiety. PEG helps delay drug elimination. The light chain is made up of 214 amino acid residues while the heavy chain is composed of 229 amino acid residues. The molecular mass of the Fab' antibody fragment itself is 47.8 kDa (i.e. Excluding the PEG moiety). FDA approved on April 22, 2008
Indication/Disease	Reducing signs and symptoms of Crohn's disease and treatment of moderately to severely active rheumatoid arthritis (RA).
Pharmacodynamics	TNFÎ± is a key pro-inflammatory cytokine with a central role in inflammatory processes. Biological activity associated to TNFÎ± include the upregulation of cellular adhesion molecules and chemokines, upregulation of major histocompatibility complex (MHC) class I and class II molecules, and direct leukocyte activation. TNFÎ± stimulates the production of downstream inflammatory mediators, including interleukin-1, prostaglandins, platelet activating factor, and nitric oxide. After treatment with certolizumab pegol, patients with Crohn's disease demonstrated a decrease in the levels of C-reactive protein (CRP).
Mechanism of Action	N.A.
Toxicity	The most common adverse reactions: upper respiratory tract infection, rash, and urinary tract infection.
Metabolism	Metabolism has not been studied in humans.
Absorption	There is a linear relationship between dose administered and Cmax and AUC. A mean Cmax of approximately 43 to 49 mcg/mL occurred at Week 5 during the initial loading dose period using the recommended dose regimen for the treatment of patients with rheumatoid arthritis (400 mg sc at Weeks 0, 2 and 4 followed by 200 mg every other week). Tmax, SubQ dose = 54 - 171 hours; Bioavailability, SubQ dose = 80% (range of 76% - 88%)
Volume of Distribution	Vd, steady state, Crohn's and RA patients = 6 - 8 L
Clearance	IV dose, healthy subjects = 9.21 mL/h to 14.38 mL/h;SC dose, Crohn's disease patients = 17 mL/h;SC dose, RA patients = 21.0 mL/h;
Categories	TNF inhibitor
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	25651776, 25645901, 25586216, 25555459, 23620660, 23451881
3-D Structure	Th1139 light Chainor (Download)Th1139 Heavy Chain (View) or (Download)