ParaPep -A Database of Anti-parasitic peptides
Detailed description page of ParaPep |
| This page displays user query in tabular form. |
1125 details |
| Primary information | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ParaPep ID | 1125 | ||||||||||||||||
| PMID | 15304333 | ||||||||||||||||
| YEAR | 2005 | ||||||||||||||||
| SEQUENCE | ACGILHDNCVYVPAQNPCCRGLQCRYGKCLVQV | ||||||||||||||||
| LENGTH | 33 | ||||||||||||||||
| NAME | Psalmopeotoxin I | ||||||||||||||||
| C-ter Modification | Amidation | ||||||||||||||||
| N-ter Modification | Free | ||||||||||||||||
| Linear/Cyclic | Cyclic(C2-19,C9-C24,C18-29) | ||||||||||||||||
| Stereochemistry | L | ||||||||||||||||
| Chemical Modification | None | ||||||||||||||||
| Disease | Malaria | ||||||||||||||||
| Assay | [3H] Hypoxanthine incorporation assay | ||||||||||||||||
| Parasite Type | Plasmodium falciparum columbian FcB1 | ||||||||||||||||
| In-vivo/vitro | In vitro | ||||||||||||||||
| Activity | IC50=1.59±1.15μM | ||||||||||||||||
| Hemolysis | No hemolysis at 10μM | ||||||||||||||||
| Nature | Antimalaraial | ||||||||||||||||
| Secondary information | |||||||||||||||||
| STRUCTURE |
| ||||||||||||||||
| DSSP states | NA | ||||||||||||||||
| SMILES | NA | ||||||||||||||||
| External Links | |||||||||||||||||
| |||||||||||||||||