A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10120 |
Swiss-prot Accession number | Q8HZR9 (Sequence in FASTA format) |
Description | Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain). |
Source organism | Ailurus fulgens (Lesser panda) (Red panda) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Ailuridae;Ailurus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids |
Protein Length | 141 Amino acids |
Molecular weight | 15067 |
References | 1 Liao M.J., Zhu M.Y., Zhang A.J.; "The lesser panda luteinizing hormone beta subunit."; Submitted (FEB-2002) to the EMBL/GenBank/DDBJ databases.
|
Domain Name | Cys_knot |
Hormone Name | Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta) |
Mature Hormone Sequence | SRGPLRPLCRPINATLAAENEACPVCVTFTTTICAGYCPSMVRVLPAILPPMPQPVCTYHELHFASIRLPGCPPGVDPMVSFPVALSCRCGPCRLSNSDCGGPRAQPLACDRPPLPGLLFL |
Position of mature hormone in Pre-Hormone protein | 121 Residues from position (21-141) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |