![]() |
|
|
|
|
|
|
HMRbase accession number | 11426 |
Swiss-prot Accession number | P21702 (Sequence in FASTA format) |
Description | Prolactin-3D1 precursor (Chorionic somatomammotropin hormone 1)(Placental lactogen I) (PL-I). |
Source organism | Rattus norvegicus (Rat) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
Subcellular location | Secreted |
Developmental Stage | Placental lactogen I is expressed in mid- pregnancy, while placental lactogen II is expressed throughout the later half of pregnancy. |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 230 Amino acids |
Molecular weight | 26324 |
References | 1 PubMed abstract 2373051 2 PubMed abstract 2373051 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin-3D1 |
Mature Hormone Sequence | SKPTAIVSTDDLYHCLVEQSHNTFIMAADVYREFDINFAKRSWMKDRILPLCHTASIHTPENLEEVHEMKTEDFLNSIINVSVSWKEPLKHLVVCSDCSSGASVSMGKKAVDMKDKNLIILEGLQTLYNRTQAKVEENFENFDYPAWSGLKDLDSSDEEHHLFAICNLCRCVKRDIHKIDTYLKVLRCRVVFKNECGVSTF |
Position of mature hormone in Pre-Hormone protein | 201 Residues from position (30-230) |
Receptor | P05710
Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |