| Primary information |
|---|
| Hemolytik ID | 4193 |
| PMID | 16460023 |
| YEAR | 2006 |
| SEQUENCE | FSISPGKVLDKFGKIVGKVLKQLKKVSAVAKV |
| LENGTH | 31 |
| NAME | P6_2 |
| C-ter Modification | Free |
| N-ter Modification | Free |
| Linear/Cyclic | Linear |
| Stereochemistry | L |
| Modified Residues | None |
| FUNCTION | Hemolytic |
| ACTIVITY | LC50=28.1µM |
| RBCs SOURCE | Human |
| Secondary information |
|---|
| Properties | Physico-Chemical details |
| STRUCTURE | |
| DSSP states | NA |
| SMILES | NA |
| External Links |
|---|
| PDB exact | PDB partial | SP exact | SP partial | TrEMBL exact | TrEMBL partial | IEDB exact | IEDB partial |
| NA |
NA |
NA |
NA |
NA |
NA |
NA |
NA |
|
| Reference Informaiton |
|---|
| ARTICLE | Lytic activity and structural differences of amphipathic peptides derived from trialysin. |
| AUTHORS | Martins RM,Sforca ML,Amino R,Juliano MA,Oyama S Jr,Juliano L,Pertinhez TA,Spisni A |
| JOURNAL | Biochemistry. 2006 Feb 14;45(6):1765-74. |
