| Primary information |
|---|
| Hemolytik ID | 3691 |
| PMID | 7989335 |
| YEAR | 1994 |
| SEQUENCE | ALWFTMLKKLGTMALHAGKAALGAAANTISQGTQ |
| LENGTH | 34 |
| NAME | DS s2 |
| C-ter Modification | Free |
| N-ter Modification | Free |
| Linear/Cyclic | Linear |
| Stereochemistry | L |
| Modified Residues | None |
| FUNCTION | Antimicrobial |
| ACTIVITY | 100% hemolysis at 70µM |
| RBCs SOURCE | Human |
| Secondary information |
|---|
| Properties | Physico-Chemical details |
| STRUCTURE | |
| DSSP states | NA |
| SMILES | NA |
| External Links |
|---|
| PDB exact | PDB partial | SP exact | SP partial | TrEMBL exact | TrEMBL partial | IEDB exact | IEDB partial |
| NA |
NA |
P80278 |
NA |
NA |
NA |
NA |
NA |
|
| Reference Informaiton |
|---|
| ARTICLE | The vertebrate peptide antibiotics dermaseptins have overlapping structural features but target specific microorganisms. |
| AUTHORS | Mor A,Hani K |
| JOURNAL | J Biol Chem. 1994 Dec 16;269(50):31635-41. |
