| Primary information |
|---|
| Hemolytik ID | 3397 |
| PMID | 10430870 |
| YEAR | 1999 |
| SEQUENCE | CSCKNKVCYRNGIPCGESCVWIPCISAALG |
| LENGTH | 30 |
| NAME | Cir A |
| C-ter Modification | Free |
| N-ter Modification | Free |
| Linear/Cyclic | Cyclic |
| Stereochemistry | L |
| Modified Residues | None |
| FUNCTION | Antimicrobial |
| ACTIVITY | 50% hemolysis at >400μM |
| RBCs SOURCE | Human |
| Secondary information |
|---|
| Properties | Physico-Chemical details |
| STRUCTURE | |
| DSSP states | NA |
| SMILES | NA |
| External Links |
|---|
| PDB exact | PDB partial | SP exact | SP partial | TrEMBL exact | TrEMBL partial | IEDB exact | IEDB partial |
| NA |
NA |
NA |
NA |
NA |
NA |
NA |
NA |
|
| Reference Informaiton |
|---|
| ARTICLE | An unusual structural motif of antimicrobial peptides containing end-to-end macrocycle and cystine-knot disulfides. |
| AUTHORS | Tam JP,Lu YA,Yang JL |
| JOURNAL | Proc Natl Acad Sci U S A. 1999 Aug 3;96(16):8913-8. |
