| Primary information |
|---|
| Hemolytik ID | 2806 |
| PMID | 20858205 |
| YEAR | 2011 |
| SEQUENCE | llgdefrkskekigkefkrivqrikdflrnlvprtes |
| LENGTH | 37 |
| NAME | D-LL37 |
| C-ter Modification | Free |
| N-ter Modification | Free |
| Linear/Cyclic | Linear |
| Stereochemistry | D |
| Modified Residues | None |
| FUNCTION | Antimicrobial |
| ACTIVITY | HC50 =125μg/ml |
| RBCs SOURCE | Human |
| Secondary information |
|---|
| Properties | Physico-Chemical details |
| STRUCTURE | |
| DSSP states | NA |
| SMILES | NA |
| External Links |
|---|
| PDB exact | PDB partial | SP exact | SP partial | TrEMBL exact | TrEMBL partial | IEDB exact | IEDB partial |
| NA |
NA |
NA |
NA |
NA |
NA |
NA |
NA |
|
| Reference Informaiton |
|---|
| ARTICLE | Anti-tuberculosis activity of ?-helical antimicrobial peptides: de novo designed L- and D-enantiomers versus L- and D-LL-37. |
| AUTHORS | Jiang Z,Higgins MP,Whitehurst J,Kisich KO,Voskuil MI |
| JOURNAL | Protein Pept Lett. 2011 Mar;18(3):241-52. |
