| Primary information |
|---|
| Hemolytik ID | 2123 |
| PMID | 11279030 |
| YEAR | 2001 |
| SEQUENCE | GWKDWLNKGKEWLKKKGPGIMKAALKAATQ |
| LENGTH | 30 |
| NAME | Ponericin-G3 |
| C-ter Modification | Free |
| N-ter Modification | Free |
| Linear/Cyclic | Linear |
| Stereochemistry | L |
| Modified Residues | None |
| FUNCTION | Antimicrobial and Insecticidal |
| ACTIVITY | Zone of inhibition not detected at 0.4-0.5mM |
| RBCs SOURCE | Horse |
| Secondary information |
|---|
| Properties | Physico-Chemical details |
| STRUCTURE | |
| DSSP states | CCTTTTTHHHHHHHTSSCCTHHHHTTSTTC |
| SMILES | NCC(=O)N[C@@H](Cc1c[nH]c(C)c1CC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](Cc1c[nH]c(C)c1CC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](Cc1c[nH]c(C)c1CC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(=O)N)C(=O)O |
| External Links |
|---|
| PDB exact | PDB partial | SP exact | SP partial | TrEMBL exact | TrEMBL partial | IEDB exact | IEDB partial |
| NA |
NA |
P82416 |
NA |
NA |
NA |
NA |
NA |
|
| Reference Informaiton |
|---|
| ARTICLE | Ponericins, new antibacterial and insecticidal peptides from the venom of the ant Pachycondyla goeldii. |
| AUTHORS | Orivel J,Redeker V,Le Caer JP, Krier, ,Krier F,Revol-Junelles AM,Longeon A,Chaffotte A,Dejean A |
| JOURNAL | J Biol Chem. 2001 May 25;276(21):17823-9. Epub 2001 Feb 22. |