Primary information |
---|
Hemolytik ID | 1075 |
PMID | 20969885 |
YEAR | 2011 |
SEQUENCE | GIWSSIKNLASKAWNSDIGQSLRNKAAGAINKFVADKIGVTPSQAAS |
LENGTH | 47 |
NAME | Vejovine |
C-ter Modification | Free |
N-ter Modification | Free |
Linear/Cyclic | Linear |
Stereochemistry | L |
Modified Residues | None |
FUNCTION | Antibacterial |
ACTIVITY | HC50 =100μM |
RBCs SOURCE | Human |
Secondary information |
---|
Properties | Physico-Chemical details |
STRUCTURE | |
DSSP states | NA |
SMILES | NA |
External Links |
---|
PDB exact | PDB partial | SP exact | SP partial | TrEMBL exact | TrEMBL partial | IEDB exact | IEDB partial |
NA |
NA |
NA |
NA |
NA |
NA |
NA |
NA |
|
Reference Informaiton |
---|
ARTICLE | Vejovine, a new antibiotic from the scorpion venom of Vaejovis mexicanus. |
AUTHORS | Hernandez-Aponte CA,Silva-Sanchez J,Quintero-Hernandez V,Rodriguez-Romero A,Balderas C,Possani LD |
JOURNAL | Toxicon. 2011 Jan;57(1):84-92. doi: 10.1016/j.toxicon.2010.10.008. Epub 2010 Oct 20. |