Primary information |
---|
CancerPDF_ID | CancerPDF_ID3038 |
PMID | 21136997 |
Peptide Sequence | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF |
Peptide Sequence in Publication | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF |
Protein Name | Inter-alpha-trypsin inhibitor heavy chain H4 |
UniprotKB Entry Name | ITIH4_HUMAN |
Biofluid | Plasma |
M/Z | 3287.6298 |
Charge | 1 |
Mass/H+ | NA |
Mass (in Daltons) | NA |
Profiling Technique | LC-MS |
Peptide Identification Technique | LC-MS-MS/MS |
Quantification Technique | LC-ESI-MS |
Labeling | Label Free |
FDR | NA |
p-Value | NA |
Software | MASCOT(v. 2.2.01) |
Length of Peptide | 30 |
Cancer Type | Normal |
Database for Peptide search | SwissProt Database |
Modification | Oxidation at Met |
Number of Patients | 27 healthy individuals |
Regulation/Differential Expression | NA |
Validation | Leave One out Cross validation |
Sensitivity | NA |
Specificity | NA |
Accuracy | NA |
Secondary information |
---|
Peptide Atlas | NA |
IEDB | |