Primary information |
---|
sequence ID | Seq_9170 |
Peptide sequence | VLSPADKTNVKAAWGKVGAHAGEYGAEALERMF |
CancerPDF_ID | CancerPDF_ID243, CancerPDF_ID10710, |
PMID | 19728888,21805675 |
Protein Name | Hemoglobin alpha,Hemoglobin subunit alpha |
UniprotKB Entry Name | HBA_HUMAN,HBA_HUMAN |
Fluid | Serum,Urine |
M/Z | 3473.7545,3473.7931 |
Charge | NA,NA |
Mass (in Da) | NA,NA |
fdr | NA,NA |
Profiling Technique | MALDI-TOF,MALDI-TOF |
Peptide Identification technique | LC-MS/MS,MALDI-TOF-MS |
Quantification Technique | NA,NA |
Labelled/Label Free | Label Free,Label Free |
FDR | NA,1 |
CancerPDF_ID | CancerPDF_ID243, CancerPDF_ID10710, |
p-Value | less than 0.05,NA |
Software | MASCOT(v 2.0.04 for Windows),NA |
Length | 33,33 |
Cancer Type | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy",Muscle-invasive bladder cancer |
Database | SwissProt Database (release 54.7),SwissProt Database |
Modification | NA,NA |
Number of Patients | "27 patients, 13 normal individuals",751 bladder cancer and 127 control |
Regulation | Signature peptide that can Differentiate between NSCLC patients and healthy volunteers,Differentially expressed between cancer vs normal samples |
Validation | Independent validation,Mann-Whitney tests and areas under receiver-operator characteristic |
Sensitivity | 1,NA |
Specificity | 0.96,NA |
Accuracy | 0.98,NA |
Peptide Atlas | NA |
IEDB | 144531
|