Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
---|---|---|---|---|---|---|---|---|
CancerPDF_ID998 | NA | NA | Serum | 6635.24 | MALDI-TOF | Colorectal cancer | Downregulated in cancer vs normal | 23091368 |
CancerPDF_ID1177 | NA | NA | Serum | 6047.99 | MALDI-TOF | Lung cancer | Upregulated in cancer vs normal with average expression of peptide in cancer 1.3 and in normal 0.86 | 21082738 |
CancerPDF_ID1178 | NA | NA | Serum | 6938.61 | MALDI-TOF | Lung cancer | Downregulated in cancer vs normal with average expression of peptide in cancer 0.55 and in normal 0.74 | 21082738 |
CancerPDF_ID1184 | NA | NA | Serum | 6431.8 | MALDI-TOF | Lung cancer | Downregulated in cancer vs normal with average expression of peptide in cancer 2.31 and in normal 4.32 | 21082738 |
CancerPDF_ID1185 | NA | NA | Serum | 6389.3 | MALDI-TOF | Lung cancer | Downregulated in cancer vs normal with average expression of peptide in cancer 0.61 and in normal 0.98 | 21082738 |
CancerPDF_ID3265 | NA | Apolipoprotein C-I | Serum | 6431 | MALDI-TOF | Stomach adenocarcinoma | Differentially expressed in cancer patients as cpmpare to normal | 21267442 |
CancerPDF_ID3266 | NA | Apolipoprotein C-I | Serum | 6629 | MALDI-TOF | Stomach adenocarcinoma | Differentially expressed in cancer patients as cpmpare to normal | 21267442 |
CancerPDF_ID3275 | NA | NA | Serum | 6636 | MALDI-TOF | Ovarian cancer | Differentially expressed between normal and patients | 22086897 |
CancerPDF_ID3291 | NA | NA | Serum | 6437.3 | MALDI-TOF | Ovarian cancer | Differentially expressed between normal and patients | 22086897 |
CancerPDF_ID3320 | NA | NA | Serum | 6385.4 | MALDI-TOF | Ovarian cancer | Differentially expressed between normal and patients | 22086897 |
CancerPDF_ID3324 | NA | NA | Serum | 6810 | MALDI-TOF | Ovarian cancer | Differentially expressed between normal and patients | 22086897 |
CancerPDF_ID3333 | NA | NA | Serum | 6231.3 | MALDI-TOF | Ovarian cancer | Differentially expressed between normal and patients | 22086897 |
CancerPDF_ID3342 | NA | NA | Serum | 6047.64 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
CancerPDF_ID3366 | NA | NA | Serum | 6387.9 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
CancerPDF_ID3367 | NA | NA | Serum | 6529.26 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
CancerPDF_ID3368 | NA | NA | Serum | 6937.21 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
CancerPDF_ID3398 | NA | NA | Serum | 6431.4 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
CancerPDF_ID3399 | NA | NA | Serum | 6629.53 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
CancerPDF_ID8419 | NA | NA | Serum | 6412.9 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 92.86% ; In Rectal cancer : 97.22% ; Breast cancer: 97%; In normal healthy individuals : 91% | 23667664 |
CancerPDF_ID8444 | NA | NA | Serum | 6626.75 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 98.57% ; In Rectal cancer : 97.22% ; Breast cancer: 98%; In normal healthy individuals : 55% | 23667664 |
CancerPDF_ID8446 | NA | NA | Serum | 6936.01 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 2.86% ; In Rectal cancer : 61.11% ; Breast cancer: 10%; In normal healthy individuals : 52% | 23667664 |
CancerPDF_ID8453 | NA | NA | Serum | 6526.74 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide in normal healthy : 45.2% | 23667664 |
CancerPDF_ID8473 | NA | NA | Serum | 6836.01 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 57.14% ; In Rectal cancer : 0% ; Breast cancer: 71%; In normal healthy individuals : 23.6% | 23667664 |
CancerPDF_ID8618 | TPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS | Apolipoprotein C-I precursor | Serum | 6625.91 | MALDI-TOF | Breast cancer | Downregulated in cancer as compare to normal control with fold change of 1.5 | 26705257 |
CancerPDF_ID8620 | ARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ | Apolipoprotein A-I precursor | Serum | 6428.21 | MALDI-TOF | Breast cancer | Downregulated in cancer as compare to normal control with fold change of 1.7 | 26705257 |
CancerPDF_ID8626 | NA | NA | Serum | 6634 | MS/MS | Esophageal squamous cell carcinoma (ESCC) | Diffrential expressed between cancer and normal | 23586861 |
CancerPDF_ID8666 | NA | NA | Serum | 6579.6 | MALDI-TOF | "Hepatocellular carcinoma, Liver cirrhosis, Chronic hepatitis" | significantly different from that of normal | 23915185 |
CancerPDF_ID11038 | NA | NA | Serum | 6433.36 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
CancerPDF_ID11109 | NA | NA | Urine | 6237.8 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in pT1b compared to pT1a patients | 26482227 |
CancerPDF_ID11133 | NA | NA | Urine | 6261.4 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
CancerPDF_ID11134 | NA | NA | Urine | 6305.2 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
CancerPDF_ID12779 | NA | NA | Serum | 6636.05 | MALDI-TOF | Hepatocellular carcinoma | Downregulated in cancer vs Healthy | 25910294 |
CancerPDF_ID14300 | NA | NA | Serum | 6629.59 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
CancerPDF_ID14303 | NA | NA | Serum | 6431.45 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
CancerPDF_ID14305 | NA | NA | Serum | 6528.84 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
CancerPDF_ID14306 | NA | NA | Serum | 6486.39 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
CancerPDF_ID14316 | NA | NA | Serum | 6389.31 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
CancerPDF_ID14329 | NA | NA | Serum | 6088.21 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
CancerPDF_ID14367 | NA | NA | Serum | 6579.6 | MB-WCX | Hepatocellular carcinoma | NA | 23915185 |