Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
---|---|---|---|---|---|---|---|---|
CancerPDF_ID961 | NA | NA | Serum | 4210.93 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
CancerPDF_ID968 | NA | NA | Serum | 4645.43 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
CancerPDF_ID969 | NA | NA | Serum | 4091.82 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
CancerPDF_ID980 | NA | NA | Serum | 4965.34 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
CancerPDF_ID981 | NA | NA | Serum | 4054.81 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
CancerPDF_ID988 | NA | NA | Serum | 4268.26 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
CancerPDF_ID989 | NA | NA | Serum | 4123.72 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
CancerPDF_ID993 | NA | NA | Serum | 4073.6 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
CancerPDF_ID996 | NA | NA | Serum | 4169.7 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
CancerPDF_ID1006 | NA | NA | Serum | 4155.14 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
CancerPDF_ID1010 | NA | NA | Serum | 4248.84 | MALDI-TOF | Colorectal cancer | Downregulated in cancer vs normal | 23091368 |
CancerPDF_ID1015 | NA | NA | Serum | 4110.58 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
CancerPDF_ID1017 | NA | NA | Serum | 4676.49 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
CancerPDF_ID1105 | NA | NA | Serum | 4820 | MALDI-TOF | Pancreatic cancer | Differentially expressed between cancer vs normal | 19470732 |
CancerPDF_ID1113 | NA | NA | Serum | 4303 | MALDI-TOF | Pancreatic cancer | Differentially expressed between cancer vs normal | 19470732 |
CancerPDF_ID1120 | NA | NA | Serum | 4055 | MALDI-TOF | Pancreatic cancer | Differentially expressed between cancer vs normal | 19470732 |
CancerPDF_ID1127 | NA | NA | Serum | 4212 | MALDI-TOF | Pancreatic cancer | Differentially expressed between cancer vs normal | 19470732 |
CancerPDF_ID1138 | NA | NA | Serum | 4469 | MALDI-TOF | Pancreatic cancer | Differentially expressed between cancer vs normal | 19470732 |
CancerPDF_ID1143 | NA | NA | Serum | 4055 | MALDI-TOF | Pancreatic cancer | Differentially expressed between cancer vs normal | 19470732 |
CancerPDF_ID1145 | NA | NA | Serum | 4055 | MALDI-TOF | Pancreatic cancer | Differentially expressed between cancer vs normal | 19470732 |
CancerPDF_ID1152 | NA | NA | Serum | 4212 | MALDI-TOF | Pancreatic cancer | Differentially expressed between cancer vs normal | 19470732 |
CancerPDF_ID1156 | NA | NA | Serum | 4820 | MALDI-TOF | Pancreatic cancer | Differentially expressed between cancer vs normal | 19470732 |
CancerPDF_ID1164 | NA | NA | Serum | 4055 | MALDI-TOF | Pancreatic cancer | Differentially expressed between cancer vs normal | 19470732 |
CancerPDF_ID1166 | NA | NA | Serum | 4215 | MALDI-TOF | Pancreatic cancer | Differentially expressed between cancer vs normal | 19470732 |
CancerPDF_ID1181 | NA | NA | Serum | 4054.39 | MALDI-TOF | Lung cancer | Downregulated in cancer vs normal with average expression of peptide in cancer 4.8 and in normal 7.91 | 21082738 |
CancerPDF_ID1187 | NA | NA | Serum | 4530.17 | MALDI-TOF | Lung cancer | Upregulated in cancer vs normal with average expression of peptide in cancer 1.23 and in normal 0.69 | 21082738 |
CancerPDF_ID1193 | NA | NA | Serum | 4210.3 | MALDI-TOF | Lung cancer | Downregulated in cancer vs normal with average expression of peptide in cancer 38.81 and in normal 51.58 | 21082738 |
CancerPDF_ID1197 | NA | NA | Serum | 4073.09 | MALDI-TOF | Lung cancer | Downregulated in cancer vs normal with average expression of peptide in cancer 3.34 and in normal 4.39 | 21082738 |
CancerPDF_ID1199 | NA | NA | Serum | 4963.95 | MALDI-TOF | Lung cancer | Downregulated in cancer vs normal with average expression of peptide in cancer 2.62 and in normal 4.19 | 21082738 |
CancerPDF_ID1205 | NA | NA | Serum | 4712.02 | MALDI-TOF | Lung cancer | Upregulated in cancer vs normal with average expression of peptide in cancer 1.03 and in normal 0.68 | 21082738 |
CancerPDF_ID2014 | KFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQ | Zyxin | Serum | 4064.96167 | LC-MS | Colorectal cancer | NA | 21136997 |
CancerPDF_ID2432 | HRHPDEAAFFDTASTGKTFPGFFSPMLGEFVSETESR | Fibrinogen alpha | Plasma | 4131.9061 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID2433 | HRHPDEAAFFDTASTGKTFPGFFSPMLGEFVSETESR | Fibrinogen alpha | Plasma | 4147.901 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID2434 | ESSSHHPGIAEFPSRGKSSSYSKQFTSSTSYNRGDSTFES | Fibrinogen alpha | Plasma | 4355.9592 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID2548 | LREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEV | Apolipoprotein A-I | Plasma | 4074.9844 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID2549 | LREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVK | Apolipoprotein A-I | Plasma | 4203.0794 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID2804 | DNENVVNEYSSELEKHQLYIDETVNSNIPTNLRVL | Fibrinogen beta chain | Plasma | 4087.9974 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID3260 | NA | NA | Serum | 4052 | MALDI-TOF | Stomach adenocarcinoma | NA | 21267442 |
CancerPDF_ID3261 | NA | Amyloid beta a4 protein | Serum | 4088 | MALDI-TOF | Stomach adenocarcinoma | NA | 21267442 |
CancerPDF_ID3262 | NA | NA | Serum | 4207 | MALDI-TOF | Stomach adenocarcinoma | NA | 21267442 |
CancerPDF_ID3270 | NA | NA | Serum | 4213.4 | MALDI-TOF | Ovarian cancer | Differentially expressed between normal and patients | 22086897 |
CancerPDF_ID3276 | NA | NA | Serum | 4647.8 | MALDI-TOF | Ovarian cancer | Differentially expressed between normal and patients | 22086897 |
CancerPDF_ID3277 | NA | NA | Serum | 4057.2 | MALDI-TOF | Ovarian cancer | Differentially expressed between normal and patients | 22086897 |
CancerPDF_ID3280 | NA | NA | Serum | 4967.9 | MALDI-TOF | Ovarian cancer | Differentially expressed between normal and patients | 22086897 |
CancerPDF_ID3285 | NA | NA | Serum | 4478.8 | MALDI-TOF | Ovarian cancer | Differentially expressed between normal and patients | 22086897 |
CancerPDF_ID3309 | NA | NA | Serum | 4285.7 | MALDI-TOF | Ovarian cancer | Differentially expressed between normal and patients | 22086897 |
CancerPDF_ID3315 | NA | NA | Serum | 4759.2 | MALDI-TOF | Ovarian cancer | Differentially expressed between normal and patients | 22086897 |
CancerPDF_ID3356 | NA | NA | Serum | 4529.7 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
CancerPDF_ID3364 | NA | NA | Serum | 4153.16 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
CancerPDF_ID3373 | NA | NA | Serum | 4194.12 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
CancerPDF_ID3379 | NA | NA | Serum | 4281.54 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
CancerPDF_ID3381 | NA | NA | Serum | 4169.93 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
CancerPDF_ID3395 | NA | NA | Serum | 4054.17 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
CancerPDF_ID8417 | NA | NA | Serum | 4617.02 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 88.57% ; In Rectal cancer : 94.44% ; Breast cancer: 93%; In normal healthy individuals : 94.2% | 23667664 |
CancerPDF_ID8418 | NA | NA | Serum | 4144.83 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 85.71% ; In Rectal cancer : 94.44% ; Breast cancer: 93%; In normal healthy individuals : 92.4% | 23667664 |
CancerPDF_ID8421 | NA | NA | Serum | 4455.33 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 81.43% ; In Rectal cancer : 88.89% ; Breast cancer: 67%; In normal healthy individuals : 86.2% | 23667664 |
CancerPDF_ID8422 | NA | NA | Serum | 4269.96 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 72.86% ; In Rectal cancer : 69.44% ; Breast cancer: 78%; In normal healthy individuals : 82.4% | 23667664 |
CancerPDF_ID8433 | NA | NA | Serum | 4130.82 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 42.86% ; In Rectal cancer : 63.89% ; Breast cancer: 49%; In normal healthy individuals : 70.6% | 23667664 |
CancerPDF_ID8436 | NA | NA | Serum | 4279.75 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 44.29% ; In Rectal cancer : 33.33% ; Breast cancer: 57%; In normal healthy individuals : 68% | 23667664 |
CancerPDF_ID8439 | NA | NA | Serum | 4626.49 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 30% ; In Rectal cancer : 55.56% ; Breast cancer: 29%; In normal healthy individuals : 64.60% | 23667664 |
CancerPDF_ID8445 | NA | NA | Serum | 4160.55 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 34.29% ; In Rectal cancer : 16.67% ; Breast cancer: 37%; In normal healthy individuals :53.2% | 23667664 |
CancerPDF_ID8452 | NA | NA | Serum | 4786.97 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 51.43% ; In Rectal cancer : 77.78% ; Breast cancer: 58%; In normal healthy individuals : 45.20% | 23667664 |
CancerPDF_ID8457 | NA | NA | Serum | 4207.72 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 25.71% ; In Rectal cancer : 38.89% ; Breast cancer: 26%; In normal healthy individuals : 37.8% | 23667664 |
CancerPDF_ID8458 | NA | NA | Serum | 4175.84 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 24.29% ; In Rectal cancer : 27.78% ; Breast cancer: 41%; In normal healthy individuals : 37.6% | 23667664 |
CancerPDF_ID8463 | NA | NA | Serum | 4342.03 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 40% ; In Rectal cancer : 50% ; Breast cancer: 32%; In normal healthy individuals : 28.8% | 23667664 |
CancerPDF_ID8464 | NA | NA | Serum | 4121.95 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 14.29% ; In Rectal cancer : 16.67% ; Breast cancer: 15%; In normal healthy individuals : 28.8% | 23667664 |
CancerPDF_ID8465 | NA | NA | Serum | 4193.63 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 8.57% ; In Rectal cancer : 8.33% ; Breast cancer: 16%; In normal healthy individuals : 28.8% | 23667664 |
CancerPDF_ID8466 | NA | NA | Serum | 4529.82 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 4.29% ; In Rectal cancer : 41.67% ; Breast cancer: 28%; In normal healthy individuals : 26.2% | 23667664 |
CancerPDF_ID8469 | NA | NA | Serum | 4237.35 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 0% ; In Rectal cancer : 19.44% ; Breast cancer: 14%; In normal healthy individuals : 25.6% | 23667664 |
CancerPDF_ID8479 | NA | NA | Serum | 4069 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | "Frequency of peptide in lung cancer : 65.7% , In normal healthy individuals : 5.6%" | 23667664 |
CancerPDF_ID8489 | NA | NA | Serum | 4057.96 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | "Frequency of peptide in rectal cancer : 58.33% , In normal healthy individuals : 15.6%" | 23667664 |
CancerPDF_ID8491 | NA | NA | Serum | 4952.82 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | "Frequency of peptide in rectal cancer :50% , In normal healthy individuals : 7.2%" | 23667664 |
CancerPDF_ID8495 | NA | NA | Serum | 4468.34 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | "Frequency of peptide in breast cancer : 95% , In normal healthy individuals : 2.6%" | 23667664 |
CancerPDF_ID8496 | NA | NA | Serum | 4057.96 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | "Frequency of peptide in breast cancer : 68% , In normal healthy individuals :1 5.6%" | 23667664 |
CancerPDF_ID8520 | SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHGTHSTK | Fibrinogen alpha | Serum | 4783.09 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
CancerPDF_ID8521 | SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHGTHSTKRG | Fibrinogen alpha | Serum | 4996.21 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
CancerPDF_ID8591 | SALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPKQA | Antichymotrypsin | Serum | 4622.49 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
CancerPDF_ID8592 | LVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPKQA | Antichymotrypsin | Serum | 4464.42 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
CancerPDF_ID8593 | VETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPKQA | Antichymotrypsin | Serum | 4351.33 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
CancerPDF_ID8596 | LEAIPMSIPPEVKFNKPFVFLMIDQNTKSPLFMGKVVNPTQK | Alpha-1 antitrypsin | Serum | 4772.55 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
CancerPDF_ID8597 | SIPPEVKFNKPFVFLMIDQNTKSPLFMGKVVNPTQK | Alpha-1 antitrypsin | Serum | 4118.21 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
CancerPDF_ID8609 | PITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE | SP40 | Serum | 4266.29 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
CancerPDF_ID8617 | NVHSAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter- trypsin inhibitor heavy chain H4 (ITIH4) fragment | Serum | 4280.55 | MALDI-TOF | Breast cancer | Upregulated in cancer as compare to normal control with fold change of 1.10 | 26705257 |
CancerPDF_ID8659 | NA | NA | Serum | 4054.21 | MALDI-TOF | "Hepatocellular carcinoma, Liver cirrhosis, Chronic hepatitis" | significantly different from that of normal | 23915185 |
CancerPDF_ID8663 | NA | NA | Serum | 4644.96 | MALDI-TOF | "Hepatocellular carcinoma, Liver cirrhosis, Chronic hepatitis" | significantly different from that of normal | 23915185 |
CancerPDF_ID8668 | NA | NA | Serum | 4055.17 | MALDI-TOF | Pancreatic cancer | Diffrentially expressed | 23991970 |
CancerPDF_ID10729 | FLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNA | Hemoglobin subunit alpha | Urine | 4018.1173 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10730 | VAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEF | Transthyretin | Urine | 4078.0221 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10731 | GDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTF | Hemoglobin subunit beta | Urine | 4106.2409 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10732 | FESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTF | Hemoglobin subunit beta | Urine | 4616.5053 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID11027 | NDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGSNGAPG | Collagen alpha-1(III) chain | Urine | 4022.7806 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID11028 | SKGESGNKGEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPPGPPG | Collagen alpha-2(I) chain | Urine | 4066.8417 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID11029 | SKGESGNKGEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPPGPPG | Collagen alpha-2(I) chain | Urine | 4114.8649 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID11030 | ARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKGEAGPQGPRGSEGPQG | Collagen alpha-1(I) chain | Urine | 4253.0061 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID11031 | ARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGSNGAPG | Collagen alpha-1(III) chain | Urine | 4306.9377 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID11032 | LQGLPGTGGPPGENGKPGEPGPKGDAGAPGAPGGKGDAGAPGERGPPG | Collagen alpha-1(III) chain | Urine | 4323.0038 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID11046 | NA | NA | Serum | 4091.86 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
CancerPDF_ID11064 | NA | NA | Serum | 4209.6 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Upregulated in ESCC patients vs control with mean intensity in cancer as 1772.59 and mean intensity in normal as 696.17 | 26993605 |
CancerPDF_ID11065 | NA | NA | Serum | 4199.6 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Upregulated in ESCC patients vs control with mean intensity in cancer as 1767.14 and mean intensity in normal as 867.09 | 26993605 |
CancerPDF_ID11066 | NA | NA | Serum | 4225.6 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Upregulated in ESCC patients vs control with mean intensity in cancer as 526.85 and mean intensity in normal as224.98 | 26993605 |
CancerPDF_ID11069 | NA | NA | Serum | 4086.1 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Upregulated in ESCC patients vs control | 26993605 |
CancerPDF_ID11092 | NA | NOTC2_HUMAN | Urine | 4026.883 | MALDI-TOF | Clear cell renal carcinoma | "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" | 26482227 |
CancerPDF_ID11093 | NA | SAFB2_HUMAN | Urine | 4355.12 | MALDI-TOF | Clear cell renal carcinoma | "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" | 26482227 |
CancerPDF_ID11094 | NA | CC168_HUMAN | Urine | 4626.92 | MALDI-TOF | Clear cell renal carcinoma | "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" | 26482227 |
CancerPDF_ID11101 | NA | SAFB2_HUMAN | Urine | 4355.1 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in pT1b compared to pT1a patients | 26482227 |
CancerPDF_ID11102 | NA | CC168_HUMAN | Urine | 4626.9 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in pT1b compared to pT1a patients | 26482227 |
CancerPDF_ID11105 | NA | NA | Urine | 4366.9 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in pT1b compared to pT1a patients | 26482227 |
CancerPDF_ID11106 | NA | NA | Urine | 4439.1 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in pT1b compared to pT1a patients | 26482227 |
CancerPDF_ID11107 | NA | NA | Urine | 4751.5 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in pT1b compared to pT1a patients | 26482227 |
CancerPDF_ID11115 | NA | NA | Urine | 4355.1 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in grade vs normal | 26482227 |
CancerPDF_ID11116 | NA | NA | Urine | 4751.5 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in grade vs normal | 26482227 |
CancerPDF_ID11127 | NA | NA | Urine | 4026.9 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
CancerPDF_ID11128 | NA | NA | Urine | 4638.5 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
CancerPDF_ID11129 | NA | NA | Urine | 4751.5 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
CancerPDF_ID11130 | NA | NA | Urine | 4962.8 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
CancerPDF_ID12765 | NA | NA | Serum | 4055.4 | MALDI-TOF | Cervical cancer | Upregulated in Cervical squamous cell carcinoma vs healthy | 26282206 |
CancerPDF_ID12766 | NA | NA | Serum | 4470.9 | MALDI-TOF | Cervical cancer | Upregulated in Cervical squamous cell carcinoma vs healthy | 26282206 |
CancerPDF_ID12772 | NA | NA | Serum | 4397.32 | MALDI-TOF | Hepatocellular carcinoma | Downregulated in cancer vs Healthy | 25910294 |
CancerPDF_ID12778 | NA | NA | Serum | 4965.18 | MALDI-TOF | Hepatocellular carcinoma | Downregulated in cancer vs Healthy | 25910294 |
CancerPDF_ID12781 | NA | NA | Serum | 4272.16 | MALDI-TOF | Hepatocellular carcinoma | Downregulated in cancer vs Healthy | 25910294 |
CancerPDF_ID12785 | NA | NA | Serum | 4210.4 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
CancerPDF_ID12788 | NA | NA | Serum | 4215.59 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
CancerPDF_ID12796 | NA | NA | Serum | 4094.16 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
CancerPDF_ID12797 | NA | NA | Serum | 4091.23 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
CancerPDF_ID12804 | NA | NA | Serum | 4649.53 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
CancerPDF_ID12808 | NA | NA | Serum | 4645.79 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
CancerPDF_ID12815 | NA | NA | Serum | 4972.38 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
CancerPDF_ID12819 | NA | NA | Serum | 4057.53 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
CancerPDF_ID12820 | NA | NA | Serum | 4055.44 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
CancerPDF_ID12825 | NA | NA | Serum | 4267.77 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
CancerPDF_ID12826 | NA | NA | Serum | 4126.53 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
CancerPDF_ID12829 | NA | NA | Serum | 4272.96 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
CancerPDF_ID12832 | NA | NA | Serum | 4078.95 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
CancerPDF_ID12833 | NA | NA | Serum | 4075.52 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
CancerPDF_ID12836 | NA | NA | Serum | 4175.08 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
CancerPDF_ID12840 | NA | NA | Serum | 4160 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
CancerPDF_ID12842 | NA | NA | Serum | 4251.24 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
CancerPDF_ID12843 | NA | NA | Serum | 4253.52 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
CancerPDF_ID14234 | NA | NA | Serum | 4008.74 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14235 | NA | NA | Serum | 4060.17 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14236 | NA | NA | Serum | 4073.65 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14237 | NA | NA | Serum | 4085.79 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14238 | NA | NA | Serum | 4097.29 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14239 | NA | NA | Serum | 4109.9 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14240 | NA | NA | Serum | 4149.54 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14241 | NA | NA | Serum | 4176.36 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14242 | NA | NA | Serum | 4200.84 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14243 | NA | NA | Serum | 4208.25 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14244 | NA | NA | Serum | 4210.42 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14245 | NA | NA | Serum | 4215.74 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14246 | NA | NA | Serum | 4226.84 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14247 | NA | NA | Serum | 4237.13 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14248 | NA | NA | Serum | 4248.09 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14249 | NA | NA | Serum | 4272.68 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14250 | NA | NA | Serum | 4286.89 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14251 | NA | NA | Serum | 4292.48 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14252 | NA | NA | Serum | 4298.29 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14253 | NA | NA | Serum | 4304.27 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14254 | NA | NA | Serum | 4314.16 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14255 | NA | NA | Serum | 4319.57 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14256 | NA | NA | Serum | 4320.42 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14257 | NA | NA | Serum | 4321.32 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14258 | NA | NA | Serum | 4327.41 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14259 | NA | NA | Serum | 4451.95 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14260 | NA | NA | Serum | 4480.21 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14261 | NA | NA | Serum | 4488.26 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14262 | NA | NA | Serum | 4651.99 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14263 | NA | NA | Serum | 4792.96 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14264 | NA | NA | Serum | 4809.18 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14265 | NA | NA | Serum | 4968.92 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14266 | NA | NA | Serum | 4993.25 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
CancerPDF_ID14304 | NA | NA | Serum | 4193.85 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
CancerPDF_ID14307 | NA | NA | Serum | 4209.86 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
CancerPDF_ID14308 | NA | NA | Serum | 4266.53 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
CancerPDF_ID14310 | NA | NA | Serum | 4053.89 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
CancerPDF_ID14311 | NA | NA | Serum | 4122.53 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
CancerPDF_ID14313 | NA | NA | Serum | 4248.53 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
CancerPDF_ID14314 | NA | NA | Serum | 4169.65 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
CancerPDF_ID14317 | NA | NA | Serum | 4017 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
CancerPDF_ID14319 | NA | NA | Serum | 4566.66 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
CancerPDF_ID14322 | NA | NA | Serum | 4153.15 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
CancerPDF_ID14327 | NA | NA | Serum | 4395.89 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
CancerPDF_ID14360 | NA | NA | Serum | 4054.21 | MB-WCX | Hepatocellular carcinoma | NA | 23915185 |
CancerPDF_ID14364 | NA | NA | Serum | 4644.96 | MB-WCX | Hepatocellular carcinoma | NA | 23915185 |