Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
---|---|---|---|---|---|---|---|---|
CancerPDF_ID241 | VLSPADKTNVKAAWGKVGAHAGEYGAEALERM | Hemoglobin alpha | Serum | 3326.6863 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Signature peptide that can Differentiate between NSCLC patients and healthy volunteers | 19728888 |
CancerPDF_ID243 | VLSPADKTNVKAAWGKVGAHAGEYGAEALERMF | Hemoglobin alpha | Serum | 3473.7545 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Signature peptide that can Differentiate between NSCLC patients and healthy volunteers | 19728888 |
CancerPDF_ID495 | GSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTWN | Fibrinogen alpha chain | Plasma | 1046.45 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
CancerPDF_ID496 | GSTGSWNSGSSGTGSTGNQNPGSPRPGSTGT | Fibrinogen alpha chain | Plasma | 946.41 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
CancerPDF_ID508 | NSGSSGTGSTGNQNPGSPRPGSTGTWNPGSSE | Fibrinogen alpha chain | Plasma | 1007.1 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
CancerPDF_ID510 | SGSSGTGSTGNQNPGSPRPGSTGTWNPGSSER | Fibrinogen alpha chain | Plasma | 1021.12 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
CancerPDF_ID511 | SGSSGTGSTGNQNPGSPRPGSTGTWNPGSSE | Fibrinogen alpha chain | Plasma | 969.09 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
CancerPDF_ID564 | SETESRGSESGIFTNTKESSSHHPGIAEFPSRGK | Fibrinogen alpha chain | Plasma | "1211.91, 909.18" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
CancerPDF_ID565 | SETESRGSESGIFTNTKESSSHHPGIAEFPSRG | Fibrinogen alpha chain | Plasma | "1169.21, 877.16" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
CancerPDF_ID566 | SETESRGSESGIFTNTKESSSHHPGIAEFPSR | Fibrinogen alpha chain | Plasma | "1150.20, 862.90" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
CancerPDF_ID595 | SGSTGQWHSESGSFRPDSPGSGNARPNNPDWGTF | Fibrinogen alpha chain | Plasma | 1192.85 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
CancerPDF_ID690 | EITRGGSTSYGTGSETESPRNPSSAGSWNSGSSGP | Fibrinogen alpha chain | Plasma | 1148.83 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
CancerPDF_ID693 | GGSTSYGTGSETESPRNPSSAGSWNSGSSGP | Fibrinogen alpha chain | Plasma | 982.41 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
CancerPDF_ID701 | GTGSETESPRNPSSAGSWNSGSSGPGSTGNR | Fibrinogen alpha chain | Plasma | 989.09 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
CancerPDF_ID837 | YEGSYALTSEEAERSDGDPVQPAVLQVHQTS | Serum deprivation-response protein | Plasma | 1121.85 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
CancerPDF_ID1288 | GKSSSYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha | Serum | 3445.57323 | LC-MS | Colorectal cancer | NA | 21136997 |
CancerPDF_ID1350 | GKSSSYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha | Serum | 3461.56814 | LC-MS | Colorectal cancer | NA | 21136997 |
CancerPDF_ID1473 | SEETKENEGFTVTAEGKGQGTLSVVTMYHAK | Complement C3 | Serum | 3327.5929 | LC-MS | Colorectal cancer | NA | 21136997 |
CancerPDF_ID1539 | TLDPERLGREGVQKEDIPPADLSDQVPDTESETR | Complement C3 | Serum | 3791.84497 | LC-MS | Colorectal cancer | NA | 21136997 |
CancerPDF_ID1780 | NVQFNYPHTSVTDVTQNNFHNYFGGSEIVVAGK | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 3682.74407 | LC-MS | Colorectal cancer | NA | 21136997 |
CancerPDF_ID1803 | YEGSYALTSEEAERSDGDPVQPAVLQVHQTS | Serum deprivation-response protein | Serum | 3362.55387 | LC-MS | Colorectal cancer | NA | 21136997 |
CancerPDF_ID2003 | LANTQPRGPPASSPAPAPKFSPVTPKFTPVAS | Zyxin | Serum | 3214.71388 | LC-MS | Colorectal cancer | NA | 21136997 |
CancerPDF_ID2004 | VSLANTQPRGPPASSPAPAPKFSPVTPKFTPVAS | Zyxin | Serum | 3400.81433 | LC-MS | Colorectal cancer | NA | 21136997 |
CancerPDF_ID2009 | EEIFPSPPPPPEEEGGPEAPIPPPPQPREKVS | Zyxin | Serum | 3426.69835 | LC-MS | Colorectal cancer | NA | 21136997 |
CancerPDF_ID2064 | KSNEQATSLNTVGGTGGIGGVGGTGGVGNRAPR | Multimerin-1 | Serum | 3025.52894 | LC-MS | Colorectal cancer | NA | 21136997 |
CancerPDF_ID2066 | KSNEQATSLNTVGGTGGIGGVGGTGGVGNRAP | Multimerin-1 | Serum | 2869.42782 | LC-MS | Colorectal cancer | NA | 21136997 |
CancerPDF_ID2196 | MVTGNPASDEIKRLPGDIQVVPIGVGPNANVQELER | von Willebrand factor | Serum | 3811.98907 | LC-MS | Colorectal cancer | NA | 21136997 |
CancerPDF_ID2198 | MVTGNPASDEIKRLPGDIQVVPIGVGPNANVQELER | von Willebrand factor | Serum | 3827.98399 | LC-MS | Colorectal cancer | NA | 21136997 |
CancerPDF_ID2233 | ATLGGPEEESTIENYASRPEAFNTPFLNIDKL | Protein UNQ467/PRO826 | Serum | 3522.71546 | LC-MS | Colorectal cancer | NA | 21136997 |
CancerPDF_ID2427 | SQLQKVPPEWKALTDMPQMRMELERPGGNEIT | Fibrinogen alpha | Plasma | 3708.8426 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID2428 | SQLQKVPPEWKALTDMPQMRMELERPGGNEIT | Fibrinogen alpha | Plasma | 3724.8375 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID2429 | SQLQKVPPEWKALTDMPQMRMELERPGGNEITR | Fibrinogen alpha | Plasma | 3864.9437 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID2547 | ATEHLSTLSEKAKPALEDLRQGLLPVLESFK | Apolipoprotein A-I | Plasma | 3419.8664 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID2548 | LREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEV | Apolipoprotein A-I | Plasma | 4074.9844 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID2549 | LREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVK | Apolipoprotein A-I | Plasma | 4203.0794 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID2640 | KLVPFATELHERLAKDSEKLKEEIGKELEEL | Apolipoprotein A-IV | Plasma | 3620.9665 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID2641 | IGDNLRELQQRLEPYADQLRTQVNTQAEQLR | Apolipoprotein A-IV | Plasma | 3694.9139 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID2643 | AKIDQNVEELKGRLTPYADEFKVKIDQTVEEL | Apolipoprotein A-IV | Plasma | 3717.9465 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID2644 | SLAPYAQDTQEKLNHQLEGLTFQMKKNAEELKA | Apolipoprotein A-IV | Plasma | 3772.9094 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID2645 | EAVEHLQKSELTQQLNALFQDKLGEVNTYAGDLQ | Apolipoprotein A-IV | Plasma | 3828.917 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID2646 | AKIDQNVEELKGRLTPYADEFKVKIDQTVEELR | Apolipoprotein A-IV | Plasma | 3874.0476 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID2737 | SEETKENEGFTVTAEGKGQGTLSVVTMYHAK | Complement C3 | Plasma | 3327.5929 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID2738 | TLDPERLGREGVQKEDIPPADLSDQVPDTESET | Complement C3 | Plasma | 3635.7439 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID2739 | TLDPERLGREGVQKEDIPPADLSDQVPDTESETR | Complement C3 | Plasma | 3791.845 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID2804 | DNENVVNEYSSELEKHQLYIDETVNSNIPTNLRVL | Fibrinogen beta chain | Plasma | 4087.9974 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID2849 | SVLGQLGITKVFSNGADLSGVTEEAPLKLSK | Alpha-1 protease inhibitor | Plasma | 3157.7234 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID2852 | SVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVH | Alpha-1 protease inhibitor | Plasma | 3464.8879 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID2895 | TSEVKQLIKAIQLTYNPDESSKPNMIDAATLK | Fibrinogen gamma | Plasma | 3545.8651 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID2896 | EGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYAL | Fibrinogen gamma | Plasma | 3713.873 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID2897 | IHLISTQSAIPYALRVELEDWNGRTSTADYAMF | Fibrinogen gamma | Plasma | 3767.8618 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID2926 | MKQTVEAMKTILDDLRAEDHFSVIDFNQNIR | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 3676.8342 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID3013 | NMATRPYSIHAHGVQTESSTVTPTLPGETLTYVW | Ceruloplasmin | Plasma | 3743.8254 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID3128 | AALKTASDFITKMDYPKQTQVSVLPEGGETPLF | Gelsolin | Plasma | 3581.8327 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID3187 | DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQI | Clusterin | Plasma | 3806.8381 | LC-MS | Normal | NA | 21136997 |
CancerPDF_ID3504 | TGARGLVGEpGpAGSKGESGNKGEpGSAGPQ | Collagen alpha-2(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
CancerPDF_ID3508 | pGPPGSpGPAGPTGKQGDRGEAGAQGPMGpSGpAG | Collagen alpha-1(II) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
CancerPDF_ID3509 | GLPGPKGEKGApGDFGpRGDQGQDGAAGpPGPpG | Collagen alpha-1(XXIII) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
CancerPDF_ID3510 | VLSPADKTNVKAAWGKVGAHAGEYGAEALER | Hemoglobin subunit alpha | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
CancerPDF_ID3511 | PAGDRGPRGERGPpGppGRDGEDGPTGPPGPpGP | Collagen alpha-2(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
CancerPDF_ID3512 | VLSPADKTNVKAAWGKVGAHAGEYGAEALERm | Hemoglobin subunit alpha | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
CancerPDF_ID3514 | DGTESSEDSFSFTVTDGTHTDFYVFPDTVFE | "FRAS1-related extracellular matrix protein 2, FREM2" | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
CancerPDF_ID3773 | GPpGADGQpGAKGEpGDAGAKGDAGpPGPAGP | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
CancerPDF_ID3776 | TGARGLVGEpGpAGSKGESGNKGEpGSAGPQ | Collagen alpha-2(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
CancerPDF_ID3779 | KGETGDVGqMGPPGPPGPRGpSGAPGADGPQGP | Collagen alpha-1(V) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
CancerPDF_ID3782 | VGpTGATGDKGPPGPVGPPGSNGpVGEpGpEGPA | Collagen alpha-2(V) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
CancerPDF_ID3783 | pGPPGSpGPAGPTGKQGDRGEAGAQGPMGpSGpAG | Collagen alpha-1(II) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
CancerPDF_ID3784 | SPGIPGSKGEqGFmGpPGPqGQPGLPGSPGHAT | Collagen alpha-1(IV) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
CancerPDF_ID3787 | GLPGPKGEKGApGDFGpRGDQGQDGAAGpPGPpG | Collagen alpha-1(XXIII) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
CancerPDF_ID3789 | QGpPGKNGETGPQGPPGPTGPGGDKGDTGPpGPQG | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
CancerPDF_ID3791 | VLSPADKTNVKAAWGKVGAHAGEYGAEALER | Hemoglobin subunit alpha | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
CancerPDF_ID3796 | GQPGTKGGpGDQGEPGPQGLpGFSGPpGKEGEpGP | Collagen alpha-2(IX) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
CancerPDF_ID3797 | PRGERGpQGNSGEKGDQGFQGQPGFPGpPGPpG | Collagen alpha-1(XVI) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
CancerPDF_ID3800 | VLSPADKTNVKAAWGKVGAHAGEYGAEALERm | Hemoglobin subunit alpha | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
CancerPDF_ID3805 | EPSCSVSSCAQPVCCEPAICEPSCSVSSCCQPVGS | Keratin-associated protein 16-1 | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
CancerPDF_ID3806 | VLSPADKTNVKAAWGKVGAHAGEYGAEALERm | Hemoglobin subunit alpha | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
CancerPDF_ID3951 | GPYPPGPLAPPQPFGPGFVPPPPPPPYGPGR | Submaxillary gland androgen-regulated protein 3B | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3956 | RGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGR | Submaxillary gland androgen-regulated protein 3B | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3960 | GPYPPGPLAPPQPFGPGFVPPPPPPPYGPGR | Submaxillary gland androgen-regulated protein 3B | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3963 | RGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGR | Submaxillary gland androgen-regulated protein 3B | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3983 | GRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGGRPQ | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID4048 | AAGLPGVAGAPGLPGPRGIPGPVGAAGATGARG | Collagen alpha-2(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID4083 | AAPSVTLFPPSSEELQANKATLVCLISDFYPGAVT | hypothetical protein XP_002348153 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID4084 | AAPSVTLFPPSSEELQANKATLVCLISDFYPGAVT | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID4085 | AAPSVTLFPPSSEELQANKATLVCLISDFYPGAVT | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID4104 | ADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGS | Neutrophil defensin 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID4170 | AGEPGRDGVPGGPGMRGMPGSPGGPGSDGKPGPPG | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID4179 | AGLPGVAGAPGLPGPRGIPGPVGAAGATGARG | Collagen alpha-2(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID4203 | AIDLPGLGHSKEAAAPAPIGELAPGSFLAAVV | Isoform 1 of Abhydrolase domain-containing protein 14B | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID4333 | AQGVGIPEDSIFTMADRGECVPGEQEPEPILIPR | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID4356 | ARGNDGARGSDGQPGPPGPPGTAGFPGSPGA | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID4430 | AWKADSSPVKAGVETTTPSKQSNNKYAASSY | hypothetical protein XP_002348153 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID4431 | AWKADSSPVKAGVETTTPSKQSNNKYAASSY | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID4432 | AWKADSSPVKAGVETTTPSKQSNNKYAASSY | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID4520 | CLSEDKKNIILEEGKEILVGDVGQTVDDPYATFV | Cofilin-1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID4553 | DAPGQYGAYFHDDGFLAFPGHVFSRSLPEVPET | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID4564 | DEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGS | Neutrophil defensin 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID4581 | DGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVY | Elongation factor 1-alpha | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID5106 | GDAGSAFAVHDLEEDTWYATGILSFDKSCAV | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID5177 | GIPEDSIFTMADRGECVPGEQEPEPILIPRV | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID5202 | GLGDALSEGVGKAIGKEAGGAAGSKVSEALGQGT | Isoform 1 of Dermokine | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID5232 | GNVGAPGAKGARGSAGPPGATGFPGAAGRVGPPGP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID5261 | GPTGTGESKCPLMVKVLDAVRGSPAINVAVH | Transthyretin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID5278 | GQPKAAPSVTLFPPSSEELQANKATLVCLISDF | hypothetical protein XP_002348153 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID5279 | GQPKAAPSVTLFPPSSEELQANKATLVCLISDF | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID5280 | GQPKAAPSVTLFPPSSEELQANKATLVCLISDF | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID5325 | GVGIPEDSIFTMADRGECVPGEQEPEPILIPR | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID5328 | GVNKLALPPGSVISYPLENAVPFSLDSVANSIHSL | Renin receptor | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID5493 | ILGLPGSRGERGLPGVAGAVGEPGPLGIAGPPG | Collagen alpha-2(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID5514 | IQVYSRHPAENGKSNFLNCYVSGFHPSDIEVD | Beta-2-microglobulin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID5515 | IQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDL | Beta-2-microglobulin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID5546 | IVNTNVPRASVPDGFLSELTQQLAQATGKPPQY | Macrophage migration inhibitory factor | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID5547 | IVNTNVPRASVPDGFLSELTQQLAQATGKPPQYI | Macrophage migration inhibitory factor | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID5559 | IYGGSVTGATCKELASQPDVDGFLVGGASLKPEFV | triosephosphate isomerase 1 isoform 2 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID5694 | LAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL | GTP-binding nuclear protein Ran | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID5722 | LDGAKGDAGPAGPKGEPGSPGENGAPGQMGPRG | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID5732 | LDLTRNALTGLPPGLFQASATLDTLVLKENQLEV | Leucine-rich alpha-2-glycoprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID5825 | LGQLGITKVFSNGADLSGVTEEAPLKLSKAV | Isoform 1 of Alpha-1-antitrypsin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID5908 | LLDPGALPALQNPPIRGGEGQNGGLPFPFPDIS | "Transforming growth factor, beta receptor III" | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID5909 | LLEDEGGSGRPLLQAAKGLAGAVSELLRSAQPA | Talin-1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID5911 | LLGAPGILGLPGSRGERGLPGVAGAVGEPGP | Collagen alpha-2(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID5912 | LLGAPGILGLPGSRGERGLPGVAGAVGEPGPL | Collagen alpha-2(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6001 | LQARADEVAAAPEQIAADIPEVVVSLAWDESLAPK | Neutrophil defensin 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6011 | LQGASKLQELHLSSNGLESLSPEFLRPVPQL | Leucine-rich alpha-2-glycoprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6072 | LSRQELFPFGPGQGDLELEDGDDFVSPALEL | Isoform 1 of Nidogen-1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6073 | LSRQELFPFGPGQGDLELEDGDDFVSPALELS | Isoform 1 of Nidogen-1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6074 | LSRQELFPFGPGQGDLELEDGDDFVSPALELSG | Isoform 1 of Nidogen-1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6075 | LSRQELFPFGPGQGDLELEDGDDFVSPALELSGAL | Isoform 1 of Nidogen-1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6286 | NIGIGGSDLGPLMVTEALKPYSSGGPRVWYV | Glucose-6-phosphate isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6310 | NLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRV | Leucine-rich alpha-2-glycoprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6313 | NLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFA | Isoform M2 of Pyruvate kinase isozymes M1/M2 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6337 | NSGSSGPGSTGNRNPGSSGTGGTATWKPGSSGP | Isoform 1 of Fibrinogen alpha chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6398 | PGESGREGAPGAEGSPGRDGSPGAKGDRGETGP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6423 | PPGESGREGAPGAEGSPGRDGSPGAKGDRGETGP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6450 | PSVFIFPPSDEQLKSGTASVVCLLNNFYPREA | 26 kDa protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6451 | PSVFIFPPSDEQLKSGTASVVCLLNNFYPREA | 26 kDa protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6452 | PSVFIFPPSDEQLKSGTASVVCLLNNFYPREA | Ig kappa chain C region | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6453 | PSVFIFPPSDEQLKSGTASVVCLLNNFYPREA | Ig kappa chain C region | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6454 | PSVFIFPPSDEQLKSGTASVVCLLNNFYPREA | IGKat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6455 | PSVFIFPPSDEQLKSGTASVVCLLNNFYPREA | IGKat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6456 | PSVFIFPPSDEQLKSGTASVVCLLNNFYPREA | IGKat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6486 | QARADEVAAAPEQIAADIPEVVVSLAWDESLAPK | Neutrophil defensin 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6501 | QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKW | Neutrophil gelatinase-associated lipocalin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6502 | QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWY | Neutrophil gelatinase-associated lipocalin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6503 | QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLY | Isoform Delta of Poliovirus receptor-related protein 2 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6504 | QEDLYPPTAGPDPALTAEEWLGGRDAGPLLI | Coronin-1A | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6544 | QLCPGCGCSTLNQYFGYSGAFKCLKDGAGDV | Serotransferrin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6564 | QPGDKGEGGAPGLPGIAGPRGSPGERGETGPPGP | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6585 | QSRALQEALVLSDRAPFAAPSPFAELVLPPQQ | Thymidine phosphorylase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6642 | RAVAIDLPGLGHSKEAAAPAPIGELAPGSFL | Isoform 1 of Abhydrolase domain-containing protein 14B | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6671 | RGSPGGPGAAGFPGARGLPGPPGSNGNPGPPGP | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6722 | RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQ | Isoform 1 of V-set and immunoglobulin domain-containing protein 4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6729 | RVVAQGVGIPEDSIFTMADRGECVPGEQEPEPI | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6738 | SAASTKGPSVFPLAPSSKSTSGGTAALGCLV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6741 | SAENVNKARSFAAGIQALGGTNINDAMLMAV | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6882 | SGRTTGIVMDSGDGVTHTVPIYEGYALPHAI | "Actin, cytoplasmic 1" | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID6884 | SGSSGPGSTGNRNPGSSGTGGTATWKPGSSGP | Isoform 1 of Fibrinogen alpha chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7179 | SVSVVETDYDQYALLYSQGSKGPGEDFRMAT | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7180 | SVSVVETDYDQYALLYSQGSKGPGEDFRMAT | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7292 | SWNSGSSGPGSTGNRNPGSSGTGGTATWKPGSSGP | Isoform 1 of Fibrinogen alpha chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7380 | TGEVGAVGPPGFAGEKGPSGEAGTAGPPGTPGP | Collagen alpha-2(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7381 | TGEVGAVGPPGFAGEKGPSGEAGTAGPPGTPGPQG | Collagen alpha-2(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7409 | TGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIG | Collagen alpha-2(V) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7427 | TGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPL | Isoform 1 of Alpha-1-antitrypsin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7479 | TLFPPSSEELQANKATLVCLISDFYPGAVTV | 25 kDa protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7480 | TLFPPSSEELQANKATLVCLISDFYPGAVTV | 25 kDa protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7481 | TLFPPSSEELQANKATLVCLISDFYPGAVTV | hypothetical protein XP_002348153 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7482 | TLFPPSSEELQANKATLVCLISDFYPGAVTV | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7483 | TLFPPSSEELQANKATLVCLISDFYPGAVTV | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7484 | TLFPPSSEELQANKATLVCLISDFYPGAVTV | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7485 | TLFPPSSEELQANKATLVCLISDFYPGAVTV | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7486 | TLFPPSSEELQANKATLVCLISDFYPGAVTV | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7487 | TLFPPSSEELQANKATLVCLISDFYPGAVTV | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7488 | TLFPPSSEELQANKATLVCLISDFYPGAVTV | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7489 | TLFPPSSEELQANKATLVCLISDFYPGAVTV | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7490 | TLFPPSSEELQANKATLVCLISDFYPGAVTV | Putative uncharacterized protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7552 | TNEIVEEQYTPQSLATLESVFQELGKLTGPNNQ | Secretogranin-2 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7604 | TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV | IGHat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7605 | TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV | Putative uncharacterized protein DKFZp686C11235 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7606 | TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV | Putative uncharacterized protein DKFZp686P15220 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7663 | TVSWNSGALTSGVHTFPAVLQSSGLYSLSSV | IGHat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7664 | TVSWNSGALTSGVHTFPAVLQSSGLYSLSSV | Putative uncharacterized protein DKFZp686C11235 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7665 | TVSWNSGALTSGVHTFPAVLQSSGLYSLSSV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7666 | TVSWNSGALTSGVHTFPAVLQSSGLYSLSSV | Putative uncharacterized protein DKFZp686I04196 (Fragment) | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7667 | TVSWNSGALTSGVHTFPAVLQSSGLYSLSSV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7668 | TVSWNSGALTSGVHTFPAVLQSSGLYSLSSV | Putative uncharacterized protein DKFZp686P15220 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7669 | TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV | IGHat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7670 | TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV | Putative uncharacterized protein DKFZp686C11235 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7671 | TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7672 | TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV | Putative uncharacterized protein DKFZp686I04196 (Fragment) | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7673 | TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7674 | TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV | Putative uncharacterized protein DKFZp686P15220 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7730 | VAWKADSSPVKAGVETTTPSKQSNNKYAASSY | hypothetical protein XP_002348153 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7731 | VAWKADSSPVKAGVETTTPSKQSNNKYAASSY | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7732 | VAWKADSSPVKAGVETTTPSKQSNNKYAASSY | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7733 | VAWKADSSPVKAGVETTTPSKQSNNKYAASSY | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7838 | VGIPEDSIFTMADRGECVPGEQEPEPILIPR | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID8086 | VVGVPGAGVPGVGVPGAGIPVVPGAGIPGAAVPG | Isoform 10 of Elastin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID8169 | WNSGSSGPGSTGNRNPGSSGTGGTATWKPGSSGP | Isoform 1 of Fibrinogen alpha chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID8281 | YGRAPQLRETLLQDFRVVAQGVGIPEDSIFT | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID8282 | YGRAPQLRETLLQDFRVVAQGVGIPEDSIFTM | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID8354 | YRAVAIDLPGLGHSKEAAAPAPIGELAPGSFL | Isoform 1 of Abhydrolase domain-containing protein 14B | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID8524 | GDSTFESKSYKMADEAGSEADHEGTHSTKRGHA | Fibrinogen alpha | Serum | 3522.53 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
CancerPDF_ID8601 | SARLNSQRLVFNRPFLMFIVDNNILFLGKVNRP | Protein c inhibitor | Serum | 3888.15 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
CancerPDF_ID8917 | GSTGSWNSGSSGTGSTGNQNPGSPRPGSTGT | Isoform 1 of Fibrinogen alpha chain | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
CancerPDF_ID9348 | TVTKTVIGPDGHKEVTKEVVTSEDGSDCPEA | Isoform 1 of Fibrinogen alpha chain | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
CancerPDF_ID9713 | SETESRGSESGIFTNTKESSSHHPGIAEFPSRG | Fibrinogen alpha chain | Serum | 877.17 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
CancerPDF_ID9762 | YNRGDSTFESKSYKMADEAGSEADHEGTHST | Fibrinogen alpha chain | Serum | 852.64 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
CancerPDF_ID9763 | GDSTFESKSYKMADEAGSEADHEGTHSTKRGHA | Fibrinogen alpha chain | Serum | 881.7 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
CancerPDF_ID9912 | FTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE | Transthyretin | Serum | 898.48 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
CancerPDF_ID10529 | AGGGSGGGNGAGGGGAGGAGGGGGGGSRAPPE | Homeobox protein SIX3 | Urine | 2281.9758 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10608 | TPCKQPRCGGGGCGGGGGGGGGGGPAGGGASPP | F-box/LRR-repeat protein 17 | Urine | 2582.1579 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10674 | DGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPG | CD99 antigen | Urine | 3022.3573 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10681 | KAVADTRDQADGSRASVDSGSSEEQGGSSRA | Polymeric immunoglobulin receptor | Urine | 3081.3834 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10690 | VLSPADKTNVKAAWGKVGAHAGEYGAEALER | Hemoglobin subunit alpha | Urine | 3195.6587 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10692 | VAWKADSSPVKAGVETTTPSKQSNNKYAASS | Ig lambda chain C regions | Urine | 3209.6254 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10696 | AWKADSSPVKAGVETTTPSKQSNNKYAASSY | Ig lambda chain C regions | Urine | 3273.6064 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10697 | VHLTPEEKSAVTALWGKVNVDEVGGEALGRL | Hemoglobin subunit beta | Urine | 3274.7428 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10701 | VLSPADKTNVKAAWGKVGAHAGEYGAEALERM | Hemoglobin subunit alpha | Urine | 3326.7238 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10703 | EEKAVADTRDQADGSRASVDSGSSEEQGGSSRA | Polymeric immunoglobulin receptor | Urine | 3339.4925 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10707 | VAWKADSSPVKAGVETTTPSKQSNNKYAASSY | Ig lambda chain C regions | Urine | 3372.6855 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10709 | EEKAVADTRDQADGSRASVDSGSSEEQGGSSRAL | Polymeric immunoglobulin receptor | Urine | 3452.5888 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10710 | VLSPADKTNVKAAWGKVGAHAGEYGAEALERMF | Hemoglobin subunit alpha | Urine | 3473.7931 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10712 | VAWKADSSPVKAGVETTTPSKQSNNKYAASSYL | Ig lambda chain C regions | Urine | 3485.7858 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10714 | PTTKTYFPHFDLSHGSAQVKGHGKKVADALTNA | Hemoglobin subunit alpha | Urine | 3523.8388 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10715 | VAVHVFRKAADDTWEPFASGKTSESGELHGLTT | Transthyretin | Urine | 3543.7714 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10716 | EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAE | Alpha-1-antitrypsin | Urine | 3557.6388 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10717 | GQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVL | Alpha-1-antitrypsin | Urine | 3578.0334 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10718 | AEYHAKATEHLSTLSEKAKPALEDLRQGLLPVL | Apolipoprotein A-I | Urine | 3629.0153 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10719 | VLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH | Hemoglobin subunit beta | Urine | 3698.9762 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10720 | EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEF | Alpha-1-antitrypsin | Urine | 3704.7076 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10721 | FVEGIYKVEIDTKSYWKALGISPFHEHAEVVF | Transthyretin | Urine | 3738.9299 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10722 | EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFA | Alpha-1-antitrypsin | Urine | 3775.7665 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10724 | AVHVFRKAADDTWEPFASGKTSESGELHGLTTEEE | Transthyretin | Urine | 3831.8486 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10725 | AEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLES | Apolipoprotein A-I | Urine | 3845.1017 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10726 | LSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNA | Hemoglobin subunit alpha | Urine | 3871.0499 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10727 | VCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH | Hemoglobin subunit beta | Urine | 3901.0777 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10729 | FLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNA | Hemoglobin subunit alpha | Urine | 4018.1173 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10973 | PPGADGQPGAKGEPGDAGAKGDAGPPGPAGP | Collagen alpha-1(I) chain | Urine | 2714.2168 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10980 | GPPGADGQPGAKGEPGDAGAKGDAGPPGPAGP | Collagen alpha-1(I) chain | Urine | 2771.2373 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10983 | LRGGAGPPGPEGGKGAAGPPGPPGAAGTPGLQG | Collagen alpha-1(III) chain | Urine | 2824.4013 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10990 | GMPGSPGGPGSDGKPGPPGSQGESGRPGPPGP | Collagen alpha-1(III) chain | Urine | 2921.2391 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10993 | ESGREGAPGAEGSPGRDGSPGAKGDRGETGP | Collagen alpha-1(I) chain | Urine | 2927.3115 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10994 | ESGREGAPGAEGSPGRDGSPGAKGDRGETGP | Collagen alpha-1(I) chain | Urine | 2943.2682 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10995 | NVGAPGAKGARGSAGPPGATGFPGAAGRVGPPGP | Collagen alpha-1(I) chain | Urine | 2974.4763 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10996 | GESGREGAPGAEGSPGRDGSPGAKGDRGETGP | Collagen alpha-1(I) chain | Urine | 2984.3374 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10997 | GESGREGAPGAEGSPGRDGSPGAKGDRGETGP | Collagen alpha-1(I) chain | Urine | 3000.2871 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10998 | ESGREGAPGAEGSPGRDGSPGAKGDRGETGPA | Collagen alpha-1(I) chain | Urine | 3014.3608 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID10999 | ARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKG | Collagen alpha-1(III) chain | Urine | 3024.3801 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID11000 | QNGEPGGKGERGAPGEKGEGGPPGVAGPPGGSGP | Collagen alpha-1(III) chain | Urine | 3059.3961 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID11002 | QNGEPGGKGERGAPGEKGEGGPPGVAGPPGGSGP | Collagen alpha-1(III) chain | Urine | 3075.3859 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID11004 | PPGESGREGAPGAEGSPGRDGSPGAKGDRGETGP | Collagen alpha-1(I) chain | Urine | 3210.4694 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID11005 | PPGESGREGAPGAEGSPGRDGSPGAKGDRGETGP | Collagen alpha-1(I) chain | Urine | 3226.3807 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID11011 | GPPGESGREGAPGAEGSPGRDGSPGAKGDRGETGP | Collagen alpha-1(I) chain | Urine | 3267.4917 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID11014 | PPGESGREGAPGAEGSPGRDGSPGAKGDRGETGPA | Collagen alpha-1(I) chain | Urine | 3281.4884 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |