Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID4202 | AIDLPGLGHSKEAAAPAPIGELAPGSFL | Isoform 1 of Abhydrolase domain-containing protein 14B | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4203 | AIDLPGLGHSKEAAAPAPIGELAPGSFLAAVV | Isoform 1 of Abhydrolase domain-containing protein 14B | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4834 | FFREALPGSGQARFS | Isoform 1 of Abhydrolase domain-containing protein 14B | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5427 | IDLPGLGHSKEAAAPAPIGELAPGSF | Isoform 1 of Abhydrolase domain-containing protein 14B | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5428 | IDLPGLGHSKEAAAPAPIGELAPGSFL | Isoform 1 of Abhydrolase domain-containing protein 14B | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5821 | LGPPVVISPSLSG | Isoform 1 of Abhydrolase domain-containing protein 14B | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6642 | RAVAIDLPGLGHSKEAAAPAPIGELAPGSFL | Isoform 1 of Abhydrolase domain-containing protein 14B | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7706 | VAIDLPGLGHSKEAAAPAPIGELAPGSFL | Isoform 1 of Abhydrolase domain-containing protein 14B | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8354 | YRAVAIDLPGLGHSKEAAAPAPIGELAPGSFL | Isoform 1 of Abhydrolase domain-containing protein 14B | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8364 | YSLPFLTAPGSQLPGFVPVAPI | Isoform 1 of Abhydrolase domain-containing protein 14B | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |