Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
---|---|---|---|---|---|---|---|---|
CancerPDF_ID3849 | FGYGY | Statherin | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3850 | FGYGYGPY | Statherin | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3851 | GYGPYQPVPEQPL | Statherin | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3852 | GYGYGPY | Statherin | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3853 | GYGYGPYQPVPEQPL | Statherin | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3854 | RFGYGYGPYQPVPEQPLYPQPYQPQ | Statherin | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3855 | YQPVPEQPL | Statherin | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3856 | YQQYTF | Statherin | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3857 | FLRR | Statherin | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3858 | IGRF | Statherin | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3859 | QYQQYTF | Statherin | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3860 | QYTF | Statherin | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3861 | RIGRF | Statherin | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3862 | GGRPSRPPQ | Basic PRP1 (Basic salivary proline-rich protein 1) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3863 | GPPAQGGSK | Basic PRP1 (Basic salivary proline-rich protein 1) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3864 | GPPPPGKPQ | Basic PRP1 (Basic salivary proline-rich protein 1) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3865 | GPPPPGKPQ | Basic PRP1 (Basic salivary proline-rich protein 1) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3866 | GPPPPPGKPQ | Basic PRP1 (Basic salivary proline-rich protein 1) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3867 | GPPPPPGKPQ | Basic PRP1 (Basic salivary proline-rich protein 1) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3868 | GPPPPPGKPQ | Basic PRP1 (Basic salivary proline-rich protein 1) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3869 | GPPPQGDK | Basic PRP1 (Basic salivary proline-rich protein 1) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3870 | GPPPQGGNQPQ | Basic PRP1 (Basic salivary proline-rich protein 1) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3871 | GPPQQEGNNPQ | Basic PRP1 (Basic salivary proline-rich protein 1) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3872 | GPPQQGGNRPQ | Basic PRP1 (Basic salivary proline-rich protein 1) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3873 | GPPRPPQGGRPSRPPQ | Basic PRP1 (Basic salivary proline-rich protein 1) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3874 | PQQPQAPPAGQPQGPPRPPQGGRPSRPPQSPPGKPQ | Basic PRP1 (Basic salivary proline-rich protein 1) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3875 | SPPGKPQ | Basic PRP1 (Basic salivary proline-rich protein 1) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3876 | SPPGKPQGPPPQGGNQPQ | Basic PRP1 (Basic salivary proline-rich protein 1) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3877 | SPPGKPQGPPPQGGNQPQ | Basic PRP1 (Basic salivary proline-rich protein 1) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3878 | GPPPQGDNK | Basic PRP1 (Basic salivary proline-rich protein 1) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3879 | GPPPQGGSK | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3880 | GGRPSRPPQ | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3881 | GPPPPGKPQ | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3882 | GPPPPGKPQ | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3883 | GPPPPGKPQGPPPQGDN | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3884 | GPPPPGKPQGPPPQGDN | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3885 | GPPPPPGKPQ | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3886 | GPPPPPGKPQ | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3887 | GPPPPPGKPQ | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3888 | GPPPQGDK | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3889 | GPPPQGDNK | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3890 | GPPPQGDNKSRSSR | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3891 | GPPPQGGNQPQ | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3892 | GPPPQGGSK | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3893 | GPPQQEGNNPQ | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3894 | GPPRPPQGGRPSRPPQ | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3895 | IAGNPQGAPPQGGN | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3896 | PQQPQAPPAGQPQGPPRPP | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3897 | SPPGKPQ | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3898 | SPPGKPQGPPPQGGNQPQ | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3899 | SPPGKPQGPPPQGGNQPQ | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3900 | GPPPQGDNK | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3901 | GPPPQGGSK | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3902 | GGRPSRPPQ | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3903 | GPPPPGKPQ | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3904 | GPPPPGKPQ | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3905 | GPPPPGKPQGPPPQGDN | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3906 | GPPPPGKPQGPPPQGDN | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3907 | GPPPPPGKPQ | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3908 | GPPPPPGKPQ | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3909 | GPPPPPGKPQ | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3910 | GPPPPPGKPQ | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3911 | GPPPQGDK | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3912 | GPPPQGDNK | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3913 | GPPPQGDNKSRSSR | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3914 | GPPPQGGNQPQ | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3915 | GPPPQGGSK | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3916 | GPPQQEGNNPQ | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3917 | GPPRPPQGGRPSRPPQ | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3918 | IAGNPQGAPPQGGN | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3919 | PQQPQAPPAGQPQGPPRPPQGGRPSRPPQ | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3920 | SPPGKPQ | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3921 | SPPGKPQGPPPQGGNQPQ | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3922 | SPPGKPQGPPPQGGNQPQ | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3923 | GGRPHRPPQGQPPQ | Basic PRP3 (Basic salivary proline-rich protein 3) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3924 | GPPPPPQGGRPHRPPQGQPPQ | Basic PRP3 (Basic salivary proline-rich protein 3) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3925 | QSLNEDVSQEESPSVISGKPEGR | Basic PRP3 (Basic salivary proline-rich protein 3) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3926 | RPHRPPQGQPPQ | Basic PRP3 (Basic salivary proline-rich protein 3) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3927 | GGRPHRPPQGQPPQ | Basic PRP3 (Basic salivary proline-rich protein 3) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3928 | GKPEGR | Basic PRP3 (Basic salivary proline-rich protein 3) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3929 | GPPPHPGKPQ | Basic PRP3 (Basic salivary proline-rich protein 3) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3930 | GRPHRPPQGQPPQ | Basic PRP3 (Basic salivary proline-rich protein 3) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3931 | PPPPQGGRPHRPP | Basic PRP3 (Basic salivary proline-rich protein 3) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3932 | QSLNEDVSQEESPSVISGKP | Basic PRP3 (Basic salivary proline-rich protein 3) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3933 | QSLNEDVSQEESPSVISGKPEGR | Basic PRP3 (Basic salivary proline-rich protein 3) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3934 | QSLNEDVSQEESPSVISGKPEGR | Basic PRP3 (Basic salivary proline-rich protein 3) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3935 | GGRPPRPAQGQQPPQ | Basic PRP4 (Basic salivary proline-rich protein 4) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3936 | GPPPPPQGGRPPRPAQGQQPPQ | Basic PRP4 (Basic salivary proline-rich protein 4) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3937 | LISGKPEGR | Basic PRP4 (Basic salivary proline-rich protein 4) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3938 | RPQGGNQPQR | Basic PRP4 (Basic salivary proline-rich protein 4) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3939 | GKPEGR | Basic PRP4 (Basic salivary proline-rich protein 4) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3940 | GPPPHPGKPE | Basic PRP4 (Basic salivary proline-rich protein 4) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3941 | GPPPPGKPQ | Basic PRP4 (Basic salivary proline-rich protein 4) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3942 | SPPGKPQ | Basic PRP4 (Basic salivary proline-rich protein 4) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3943 | APPQPFGPGFVPPPPPPPYGPGR | Submaxillary gland androgen-regulated protein 3B | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3944 | FVPPPPPPPYGPGR | Submaxillary gland androgen-regulated protein 3B | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3945 | GFVPPPPPPPYGPGR | Submaxillary gland androgen-regulated protein 3B | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3946 | GIFPPPPPQP | Submaxillary gland androgen-regulated protein 3B | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3947 | GPGFVPPPPPPPYGPGR | Submaxillary gland androgen-regulated protein 3B | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3948 | GPGIFPPPPPQP | Submaxillary gland androgen-regulated protein 3B | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3949 | GPYPPGPL | Submaxillary gland androgen-regulated protein 3B | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3950 | GPYPPGPLAPPQPF | Submaxillary gland androgen-regulated protein 3B | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3951 | GPYPPGPLAPPQPFGPGFVPPPPPPPYGPGR | Submaxillary gland androgen-regulated protein 3B | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3952 | GRIPPPPPAPY | Submaxillary gland androgen-regulated protein 3B | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3953 | GRIPPPPPAPY | Submaxillary gland androgen-regulated protein 3B | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3954 | QPFGPGFVPPPPPPPYGPGR | Submaxillary gland androgen-regulated protein 3B | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3955 | RGPYPPGPLAPPQPF | Submaxillary gland androgen-regulated protein 3B | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3956 | RGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGR | Submaxillary gland androgen-regulated protein 3B | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3957 | YPPGPLAPPQPFGPGFVPPPPPPPYGPGR | Submaxillary gland androgen-regulated protein 3B | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3958 | APPQPFGPGFVPPPPPPPYGPGR | Submaxillary gland androgen-regulated protein 3B | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3959 | GPLAPPQPFGPGFVPPPPPPPYGPGR | Submaxillary gland androgen-regulated protein 3B | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3960 | GPYPPGPLAPPQPFGPGFVPPPPPPPYGPGR | Submaxillary gland androgen-regulated protein 3B | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3961 | LAPPQPFGPGFVPPPPPPPYGPGR | Submaxillary gland androgen-regulated protein 3B | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3962 | PGPLAPPQPFGPGFVPPPPPPPYGPGR | Submaxillary gland androgen-regulated protein 3B | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3963 | RGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGR | Submaxillary gland androgen-regulated protein 3B | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3964 | YPPGPLAPPQPFGPGFVPPPPPPPYGPGR | Submaxillary gland androgen-regulated protein 3B | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3965 | DGGDSEQFIDEER | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3966 | GGDSEQFIDEER | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3967 | GGDSEQFIDEER | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3968 | GGHPPPPQGRPQ | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3969 | GGRPQGPPQGQSPQ | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3970 | GPPPPPPGKPQ | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3971 | GPPPQGGRPQ | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3972 | GPPPQGGRPQGPPQGQSPQ | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3973 | GPPQGQSPQ | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3974 | GPPQQGGHP | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3975 | GPPQQGGHPPPPQGR | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3976 | GPPQQGGHPPPPQGRPQ | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3977 | GPPQQGGHPRPP | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3978 | GPPQQGGHPRPPR | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3979 | GPPQQGGHQQ | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3980 | GRPQGPPQQGGHQ | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3981 | GRPQGPPQQGGHQQ | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3982 | GRPQGPPQQGGHQQGPPPPPPGKPQ | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3983 | GRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGGRPQ | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3984 | PQGPPQQGGHPRPPR | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3985 | RGRPQGPPQQGGHQQ | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3986 | RPQGPPQQGGHQQ | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3987 | RPQGPPQQGGHQQ | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3988 | DSEQFIDEER | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3989 | FIDEER | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3990 | GPPPPPPGKPQ | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3991 | GPPPPPPGKPQGPPPQGGRPQGPPQGQSPQ | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3992 | GPPQGQSPQ | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3993 | GPPQGQSPQ | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3994 | GPPQQGGHPPPPQGRPQ | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3995 | GPPQQGGHPPPPQGRPQ | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3996 | GRPQGPPQGQSP | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3997 | GRPQGPPQQ | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3998 | GRPQGPPQQGGH | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID3999 | GRPQGPPQQGGHPRPPR | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID4000 | GRPQGPPQQGGHQQ | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID4001 | DGGDSEQFIDEER | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID4002 | GGDSEQFIDEER | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID4003 | GGDSEQFIDEER | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
CancerPDF_ID9918 | GPPPPGKPQGPPPQGDKS | Basic salivary proline-rich protein 1 | Saliva | 2077.94 | MALDI-TOF | Head and neck cancer | Differentially expressed between Head and neck cancer vs control groups | 20879038 |
CancerPDF_ID9919 | KPQGPPPQGDKSQSPRSPPGK | Basic salivary proline-rich protein 1 | Saliva | 2220.07 | MALDI-TOF | Head and neck cancer | Differentially expressed between Head and neck cancer vs control groups | 20879038 |
CancerPDF_ID9920 | GPPPQGGNKSQGPPPPGKPQ | Basic salivary proline-rich protein 2 | Saliva | 2125.04 | MALDI-TOF | Head and neck cancer | Differentially expressed between Head and neck cancer vs control groups | 20879038 |
CancerPDF_ID9921 | GPPPQGDNKSQSARSPPGKPQ | Basic salivary proline-rich protein 2 | Saliva | 2333.15 | MALDI-TOF | Head and neck cancer | Differentially expressed between Head and neck cancer vs control groups | 20879038 |
CancerPDF_ID9922 | GPPPQGGNKPQGPPPPGKPQGPPPQGDKS | Basic salivary proline-rich protein 2 | Saliva | 3135.59 | MALDI-TOF | Head and neck cancer | Differentially expressed between Head and neck cancer vs control groups | 20879038 |
CancerPDF_ID9923 | QPQAPPAGQPQGPPRPPQ | Basic salivary proline-rich protein 2 | Saliva | 1830.81 | MALDI-TOF | Head and neck cancer | Differentially expressed between Head and neck cancer vs control groups | 20879038 |
CancerPDF_ID9924 | QRPPPPP | Basic salivary proline-rich protein 4 | Saliva | 771.4 | MALDI-TOF | Head and neck cancer | Differentially expressed between Head and neck cancer vs control groups | 20879038 |
CancerPDF_ID9925 | QGPPPPPQGGRPP | Basic salivary proline-rich protein 4 | Saliva | 1264.63 | MALDI-TOF | Head and neck cancer | Differentially expressed between Head and neck cancer vs control groups | 20879038 |
CancerPDF_ID9926 | QSHRPPPPPGKPE | Basic salivary proline-rich protein 4 | Saliva | 1406.71 | MALDI-TOF | Head and neck cancer | Differentially expressed between Head and neck cancer vs control groups | 20879038 |
CancerPDF_ID9927 | QSQGPPPHPGKPERPPP | Basic salivary proline-rich protein 4 | Saliva | 1785.85 | MALDI-TOF | Head and neck cancer | Differentially expressed between Head and neck cancer vs control groups | 20879038 |
CancerPDF_ID9928 | QSQGPPPHPGKPEGPPPQ | Basic salivary proline-rich protein 4 | Saliva | 1814.83 | MALDI-TOF | Head and neck cancer | Differentially expressed between Head and neck cancer vs control groups | 20879038 |
CancerPDF_ID9929 | QSQGPPPHPGKPEGPPPQEGNKS | Basic salivary proline-rich protein 4 | Saliva | 2330.09 | MALDI-TOF | Head and neck cancer | Differentially expressed between Head and neck cancer vs control groups | 20879038 |
CancerPDF_ID9930 | QSQGPPPHPGKPEGPPPQEGNKSR | Basic salivary proline-rich protein 4 | Saliva | 2486.2 | MALDI-TOF | Head and neck cancer | Differentially expressed between Head and neck cancer vs control groups | 20879038 |
CancerPDF_ID9931 | VISDGGDSEQFIDEER | Salivary acidic proline-rich phosphoprotein 1/2 | Saliva | 1875.74 | MALDI-TOF | Head and neck cancer | Differentially expressed between Head and neck cancer vs control groups | 20879038 |
CancerPDF_ID9932 | VISDGGDSEQFIDEERQ | Salivary acidic proline-rich phosphoprotein 1/2 | Saliva | 2003.82 | MALDI-TOF | Head and neck cancer | Differentially expressed between Head and neck cancer vs control groups | 20879038 |