Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID5208 | GLMGYRLSPQTLTTI | Grancalcin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5694 | LAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL | GTP-binding nuclear protein Ran | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5724 | LDGYSGPAYSDTY | Grancalcin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID13592 | DPNLEFVAM | GTP-binding nuclear protein Ran | Plasma | 1035.482 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |