Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID4062 | AAPEAQVSVQPNFQQDKFLGRWF | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4064 | AAPEAQVSVQPNFQQDKFLGRWFSA | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4066 | AAPEAQVSVQPNFQQDKFLGRWFSAGL | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4146 | AFCKAQGFTEDTI | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4148 | AFCKAQGFTEDTIV | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4150 | AFCKAQGFTEDTIVFLPQTDKCMTEQ | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4253 | ALLYSQGSKGPGEDFR | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4255 | ALLYSQGSKGPGEDFRM | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4257 | ALLYSQGSKGPGEDFRMA | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4259 | ALLYSQGSKGPGEDFRMAT | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4260 | ALLYSQGSKGPGEDFRMATL | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4262 | ALLYSQGSKGPGEDFRMATLY | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4303 | APEAQVSVQPNFQQDKF | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4306 | APEAQVSVQPNFQQDKFLGRWFSA | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4307 | APEAQVSVQPNFQQDKFLGRWFSAGL | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4337 | AQVSVQPNFQQDKF | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4339 | AQVSVQPNFQQDKFL | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4340 | AQVSVQPNFQQDKFLG | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4344 | AQVSVQPNFQQDKFLGRWFSA | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4346 | AQVSVQPNFQQDKFLGRWFSAG | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4348 | AQVSVQPNFQQDKFLGRWFSAGL | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4640 | DLQAAPEAQVSVQPNFQQDKFLGRWF | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4641 | DLQAAPEAQVSVQPNFQQDKFLGRWFSAGL | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4705 | DYDQYALLYSQGSKGPGEDFRMA | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4707 | DYDQYALLYSQGSKGPGEDFRMAT | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4718 | EAQVSVQPNFQQDKFLGRWF | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4787 | ETDYDQYALLYSQGSKGPGEDFRMAT | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4796 | FCKAQGFTEDTI | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5049 | FTEDTIVFLPQTDKCMTEQ | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5130 | GFTEDTIVFLPQTDKCMTEQ | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5292 | GSKGPGEDFRMATL | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5294 | GSLGSYSYRSPHWGSTY | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5541 | IVFLPQTDKCMT | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5930 | LLQPAGSLGSYSYR | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5944 | LLYSQGSKGPGEDFRMA | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5946 | LLYSQGSKGPGEDFRMAT | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5948 | LLYSQGSKGPGEDFRMATL | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6022 | LQPAGSLGSYS | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6023 | LQPAGSLGSYSYRSPHWGSTY | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6152 | LYSQGSKGPGEDFRMA | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6154 | LYSQGSKGPGEDFRMAT | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6156 | LYSQGSKGPGEDFRMATL | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6195 | MLLQPAGSLGSY | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6413 | PNFQQDKFLGRW | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6465 | QAAPEAQVSVQPNFQQDKFLGRWF | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6570 | QPNFQQDKFLGRWF | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6599 | QVSVQPNFQQDKFLGRWFSA | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6601 | QVSVQPNFQQDKFLGRWFSAG | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6603 | QVSVQPNFQQDKFLGRWFSAGL | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7170 | SVQPNFQQDKFLGRWF | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7172 | SVQPNFQQDKFLGRWFSA | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7176 | SVSVVETDYDQY | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7178 | SVSVVETDYDQYA | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7180 | SVSVVETDYDQYALLYSQGSKGPGEDFRMAT | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7186 | SVVETDYDQY | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7188 | SVVETDYDQYA | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7190 | SVVETDYDQYAL | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7192 | SVVETDYDQYALLY | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7194 | SVVETDYDQYALLYSQGSKGPGEDFRMA | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7196 | SVVETDYDQYALLYSQGSKGPGEDFRMAT | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7198 | SVVETDYDQYALLYSQGSKGPGEDFRMATL | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7335 | TAFCKAQGF | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7337 | TAFCKAQGFTEDT | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7339 | TAFCKAQGFTEDTI | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7341 | TAFCKAQGFTEDTIV | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7343 | TAFCKAQGFTEDTIVFLPQTDKCMTEQ | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7363 | TDYDQYALLYSQGSKGPGEDFRM | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7365 | TDYDQYALLYSQGSKGPGEDFRMA | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7367 | TDYDQYALLYSQGSKGPGEDFRMATL | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7549 | TMLLQPAGSLGSYSYR | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7792 | VETDYDQYALLYSQGSKGPGEDFRM | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7794 | VETDYDQYALLYSQGSKGPGEDFRMA | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7796 | VETDYDQYALLYSQGSKGPGEDFRMAT | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7798 | VETDYDQYALLYSQGSKGPGEDFRMATL | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8010 | VSVQPNFQQDKFLGRWF | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8071 | VVETDYDQYA | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8074 | VVETDYDQYALL | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8076 | VVETDYDQYALLYSQGSKGPGEDFRMA | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8078 | VVETDYDQYALLYSQGSKGPGEDFRMATL | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8079 | VVETDYDQYALLYSQGSKGPGEDFRMATLY | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8358 | YRSPHWGSTYS | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8368 | YSQGSKGPGEDFRM | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8369 | YSQGSKGPGEDFRMA | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8371 | YSQGSKGPGEDFRMAT | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8380 | YSVSVVETDYDQYALL | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID9281 | TAFCKAQGFTED | Prostaglandin-H2 D-isomerase | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9977 | YRSPHWGST | Prostaglandin-H2 D-isomerase | Urine | 1090.4961 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10020 | QQDKFLGRW | Prostaglandin-H2 D-isomerase | Urine | 1177.6029 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10049 | YRSPHWGSTY | Prostaglandin-H2 D-isomerase | Urine | 1253.5665 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10077 | YSRTQTPRAEL | Prostaglandin-H2 D-isomerase | Urine | 1321.6704 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10089 | YSYRSPHWGST | Prostaglandin-H2 D-isomerase | Urine | 1340.5888 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10123 | VSVQPNFQQDKF | Prostaglandin-H2 D-isomerase | Urine | 1436.6688 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10165 | YSYRSPHWGSTY | Prostaglandin-H2 D-isomerase | Urine | 1503.638 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10348 | YSQGSKGPGEDFRMATL | Prostaglandin-H2 D-isomerase | Urine | 1843.8586 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10393 | VSVQPNFQQDKFLGRW | Prostaglandin-H2 D-isomerase | Urine | 1948.9773 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10482 | AQVSVQPNFQQDKFLGRW | Prostaglandin-H2 D-isomerase | Urine | 2148.0733 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10496 | YSRTQTPRAELKEKFTAF | Prostaglandin-H2 D-isomerase | Urine | 2173.1237 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10574 | VSVQPNFQQDKFLGRWFSAGL | Prostaglandin-H2 D-isomerase | Urine | 2424.244 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10577 | APEAQVSVQPNFQQDKFLGRW | Prostaglandin-H2 D-isomerase | Urine | 2445.2213 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10614 | AQVSVQPNFQQDKFLGRWFSAGL | Prostaglandin-H2 D-isomerase | Urine | 2623.3379 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10666 | APEAQVSVQPNFQQDKFLGRWFSAGL | Prostaglandin-H2 D-isomerase | Urine | 2920.478 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11075 | NA | PTGDS_HUMAN | Urine | 1525 | MALDI-TOF | Clear cell renal carcinoma | NA | 26482227 |
| CancerPDF_ID11095 | NA | PTGDS_HUMAN | Urine | 1525 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in pT1b compared to pT1a patients | 26482227 |