Browse result page of CancerPDF Database

Please click on CancerPDF_ID for detailed information about peptide.

CancerPDF_ID	Peptide seq	Protein Name	Fluid	Mass/Z	Profiling Technique	Cancer Type	Expression Regulation	PUBMED ID
CancerPDF_ID8620	ARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ	Apolipoprotein A-I precursor	Serum	6428.21	MALDI-TOF	Breast cancer	Downregulated in cancer as compare to normal control with fold change of 1.7	26705257