Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID3411 | PpGEAGKpGEQGVPGDLG | Collagen alpha-1(I) chain | Urine | NA | CE-MS-TOF | Bladder cancer | Downregulated in cancer vs normal | 21591268 |
| CancerPDF_ID3419 | PpGPpGpPGPpS | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3425 | DDGEAGKpGRpG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3440 | GPPGpPGPpGPPGPPS | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3445 | VGpPGPPGpPGPPGPPS | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3457 | TGDAGpVGPpGPpGPPGPP | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3459 | PpGEAGKpGEQGVpGDLG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3461 | EpGSpGENGApGQMGPRG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3471 | EGSpGRDGSpGAKGDRGET | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3486 | NGDDGEAGKPGRpGERGPpGPQG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3487 | NGDDGEAGKPGRPGERGppGpQG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3494 | GPpGKNGDDGEAGKpGRpGERGPPGP | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3522 | PpGEAGKpG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3531 | pGDRGEpGPp | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3532 | SpGPDGKTGpP | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3534 | DGEAGKpGRpG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3542 | PpGEAGKpGEQG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3552 | ApGDRGEpGPPGp | "Collagen alpha-1(I) chain, Collagen alpha- 1(I) chain (Alpha-1 type I collagen)" | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3560 | SpGSPGPDGKTGPp | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3561 | SpGSpGPDGKTGPp | Collagen alpha1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3563 | GSpGAKGDRGETGP | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3566 | GLpGPpGERGGpGS | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3583 | GARGEPGpTGLpGPpG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3585 | GPPGkNGDDGEAGKPG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3588 | DGSpGAKGDRGETGPA | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3592 | ApGNDGAKGDAGApGApG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3620 | TGDAGpVGPpGPpGPPGPP | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3623 | GNSGEpGApGSKGDTGAKG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3624 | SpGRDGSpGAKGDRGET | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3625 | PpGPPGkNGDDGEAGKpG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3629 | EpGSPGENGApGQMGPRG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3632 | EpGSpGENGApGQMGPRG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3637 | EpGSpGENGApGQmGPRG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3639 | PGPAGARGnDGATGAAGPpGP | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3640 | QGPGGPpGPKGNSGEpGApG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3650 | GEpGSpGENGApGQMGPRG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3651 | NDGAKGDAGApGApGSQGApG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3652 | GEpGSpGENGApGQMGPRG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3653 | VGPpGPpGPpGPpGPPSAGF | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3656 | GEpGSpGENGAPGQmGpRG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3666 | NSGEpGApGSKGDTGAKGEp | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3667 | EGSpGRDGSpGAKGDRGET | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3674 | DDGEAGKPGRpGERGPpGp | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3677 | SGEpGApGSKGDTGAKGEpGP | "Collagen alpha-1(I) chain, Collagen alpha- 1(I) chain (Alpha-1 type I collagen)" | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3678 | RGEPGPpGPAGAAGPAGnpGAD | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3679 | NGApGNDGAKGDAGApGApGSQ | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3698 | GppGESGREGApGAEGSPGRDG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3702 | NGDDGEAGKpGRpGERGPPGP | "Collagen alpha-1(I) chain, Collagen alpha- 1(I) chain (Alpha-1 type I collagen)" | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3703 | NGDDGEAGKpGRPGERGpPGp | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3707 | GpPGEAGKpGEQGVpGDLGAPGp | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3717 | ADGQPGAKGEPGDAGAKGDAGPpGP | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3721 | ADGQpGAKGEpGDAGAKGDAGPPGp | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3723 | ADGQpGAKGEpGDAGAKGDAGppGP | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3725 | ANGApGNDGAKGDAGApGApGSQGAPG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3727 | GLpGpAGpPGEAGKPGEQGVpGDLG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3728 | EGGKGPRGETGpAGRpGEVGppGP | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3736 | GANGApGNDGAKGDAGApGApGSQGApG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3737 | KGNSGEPGApGSKGDTGAKGEPGpVG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3742 | KGNSGEpGAPGSKGDTGAKGEpGpVG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3743 | KNGDDGEAGKpGRPGERGpPGPQG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3744 | KGNSGEpGApGSKGDTGAKGEpGpVG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3746 | SGNAGPpGPPGPAGKEGGKGpRGETGP | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3750 | ADGQpGAKGEpGDAGAKGDAGPpGPAGP | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3773 | GPpGADGQpGAKGEpGDAGAKGDAGpPGPAGP | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3774 | GPPGESGREGApGAEGSPGRDGSPGAKGDR | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3775 | VQGPpGpAGEEGKRGARGEPGPTGLpGPpG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3794 | AAGEpGKAGERGVpGPpGAVGPAGKDGEAGAQGPPGP | "Collagen alpha-1(I) chain, Collagen alpha-1(I) chain (Alpha-1 type I collagen)" | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3804 | PpGPAGFAGPPGADGQPGAKGEpGDAGAKGDAGPPGPAGP | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3809 | GPPGPAGFAGPPGADGQpGAKGEpGDAGAKGDAGPpGPAGPAG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3810 | FAGpPGADGQPGAKGEpGDAGAKGDAGPpGPAGPAGPpGPIG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3821 | GNDGATGAAGPPGPTGpAGPPGFPGAVGAKGEAGpQGpRGSEGpQG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID4181 | AGPPGATGFPGAAGRVGPPGP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4182 | AGPPGEAGKPGEQGVPGD | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4191 | AGSPGFQGLPGPAGPPGEAGKPGEQGVPGDLGAPGP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4291 | ANGAPGNDGAKGDAGAPGAPGSQGAPG | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4368 | ATGFPGAAGRVGPPGP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4571 | DFINDATDVNDALGYVTRF | Collagen alpha-1(VI) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4575 | DFSFLPQPPQE | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4582 | DGPAGAPGTPGPQG | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4583 | DGQPGAKGEPGDAGAK | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4773 | EPGSPGENGAPGQMGPRG | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4775 | ERGEQGPAGSPGFQGLPGPAGPPGEAGKPGEQGVPGD | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4778 | ESGREGAPGAEGSPGRD | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4991 | FPGAAGRVGPPGP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4992 | FPGAAGRVGPPGPSGNAGPPGPPGP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5026 | FSGLQGPPGPPGSPGEQGP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5027 | FSGLQGPPGPPGSPGEQGPSG | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5094 | GARGSAGPPGATGFPGAAGRVGPPGP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5111 | GEAGAQGPPGP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5112 | GEAGAQGPPGPAGPAG | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5113 | GEAGKPGEQGVPGDLGAPGP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5121 | GEPGEPGASGPMGPRGPPGPPG | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5122 | GESGREGAPGAEGSPGRD | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5126 | GFPGAAGRVGPPGP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5127 | GFPGAAGRVGPPGPSGNAGPPGPPGP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5232 | GNVGAPGAKGARGSAGPPGATGFPGAAGRVGPPGP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5236 | GPDGKTGPPGP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5239 | GPPGEAGKPGEQG | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5240 | GPPGEAGKPGEQGVPGD | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5241 | GPPGPPGPPGPP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5244 | GPPGPPGPPGPP | Isoform 1 of EMI domain-containing protein 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5245 | GPPGPPGPPGPP | Isoform 2 of Collagen alpha-1(XVIII) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5247 | GPPGPPGPPGPPGPPSAGF | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5248 | GPPGPPGPPGPPGPPSAGFDF | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5249 | GPPGPPGPPGPPGPPSAGFDFS | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5251 | GPPGPPGPPGPPSAGFD | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5252 | GPPGPPGPPGPPSAGFDF | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5253 | GPPGPPGPPGPPSAGFDFS | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5254 | GPPGPPGPPGVSGGGYDFG | Collagen alpha-2(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5255 | GPPGPPGPPSAGFDF | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5285 | GSAGPPGATGFPGAAGRVGPPGP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5296 | GSPGSPGPDGKTGPPGP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5297 | GSPGSPGPDGKTGPPGPAG | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5595 | KGNSGEPGAPGSKGDTGAKGEPGPVG | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5722 | LDGAKGDAGPAGPKGEPGSPGENGAPGQMGPRG | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6275 | NGAPGNDGAKGDAGAPGAPGSQGAPG | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6390 | PAGPPGEAGKPGEQGVPGDLGAPGP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6396 | PGAAGRVGPPGP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6398 | PGESGREGAPGAEGSPGRDGSPGAKGDRGETGP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6422 | PPGEAGKPGEQGVPGD | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6423 | PPGESGREGAPGAEGSPGRDGSPGAKGDRGETGP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6425 | PPGPPGPPGPPGPP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6427 | PPGPPGPPGPPGPPSAGFDF | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6428 | PPGPPGPPGPPGPPSAGFDFS | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6499 | QDGRPGPPGPPG | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6530 | QGPPGEPGEPGASGPMGPRGPPGPPG | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6670 | RGPPGPPGKNGDDGEAGKPGRPGERGPPGP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6748 | SAGPPGATGFPGAAGRVGPPGP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7035 | SPGENGAPGQMGPRG | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7036 | SPGFQGLPGPAGPPGEAGKPGEQGVPGDLGAPGPSG | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7042 | SPGSPGPDGKTGPP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7043 | SPGSPGPDGKTGPPGPAG | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7413 | TGSPGSPGPDGKTGPPGP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7843 | VGPPGPPGPPGPPGPPSAGFD | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7844 | VGPPGPPGPPGPPGPPSAGFDFSFL | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7845 | VGPPGPPGPPGPPGPPSAGFDFSFLPQPP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID10009 | GPIGPPGPAGAPGD | Collagen alpha-1(I) chain | Urine | 1159.5427 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10462 | DGQPGAKGEPGDAGAKGDAGPPGP | Collagen alpha-1(I) chain | Urine | 2102.93 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10506 | LDGAKGDAGPAGPKGEPGSPGENGA | Collagen alpha-1(I) chain | Urine | 2206.0017 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10766 | DGRPGPPGPPG | Collagen alpha-1(I) chain | Urine | 1051.4902 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10770 | GPPGPPGPPGPPS | Collagen alpha-1(I) chain | Urine | 1142.5414 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10772 | GPPGPPGPPGPPS | Collagen alpha-1(I) chain | Urine | 1158.5322 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10775 | GPVGPPGPPGPPG | Collagen alpha-1(I) chain | Urine | 1162.5267 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10777 | PGDRGEPGPPGP | Collagen alpha-1(I) chain | Urine | 1180.5198 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10779 | GQDGRPGPPGPPG | Collagen alpha-1(I) chain | Urine | 1236.5608 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10780 | APGDRGEPGPPGP | Collagen alpha-1(I) chain | Urine | 1251.5419 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10783 | GQDGRPGPPGPPGA | Collagen alpha-1(I) chain | Urine | 1307.6132 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10784 | APGDRGEPGPPGPA | Collagen alpha-1(I) chain | Urine | 1322.5948 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10785 | PPGPPGPPGPPGPPS | Collagen alpha-1(I) chain | Urine | 1352.6365 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10787 | APGDRGEPGPPGPAG | Collagen alpha-1(I) chain | Urine | 1379.6193 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10789 | GPPGPPGPPGPPGPPS | Collagen alpha-1(I) chain | Urine | 1409.6706 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10791 | GPPGPPGPPGPPGPPS | Collagen alpha-1(I) chain | Urine | 1425.6628 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10793 | SPGSPGPDGKTGPPGP | Collagen alpha-1(I) chain | Urine | 1436.6463 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10794 | EPGKAGERGVPGPPG | Collagen alpha-1(I) chain | Urine | 1436.6914 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10799 | SPGSPGPDGKTGPPGP | Collagen alpha-1(I) chain | Urine | 1452.6738 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10801 | VGPPGPPGPPGPPGPPS | Collagen alpha-1(I) chain | Urine | 1508.7205 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10802 | VGPPGPPGPPGPPGPPS | Collagen alpha-1(I) chain | Urine | 1524.7269 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10803 | VGPPGPSGNAGPPGPPGP | Collagen alpha-1(I) chain | Urine | 1540.7191 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10806 | SPGSPGPDGKTGPPGPAG | Collagen alpha-1(I) chain | Urine | 1580.7286 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10815 | PPGEAGKPGEQGVPGDLG | Collagen alpha-1(I) chain | Urine | 1709.7991 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10817 | GPPGPPGKNGDDGEAGKPG | Collagen alpha-1(I) chain | Urine | 1735.789 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10819 | TGSPGSPGPDGKTGPPGPAG | Collagen alpha-1(I) chain | Urine | 1738.7988 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10820 | EPGSPGENGAPGQMGPRG | Collagen alpha-1(I) chain | Urine | 1742.7158 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10822 | GPPGPPGKNGDDGEAGKPG | Collagen alpha-1(I) chain | Urine | 1751.803 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10824 | DGEAGKPGRPGERGPPGP | Collagen alpha-1(I) chain | Urine | 1762.83 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10827 | GEPGSPGENGAPGQMGPRG | Collagen alpha-1(I) chain | Urine | 1799.7353 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10830 | SPGRDGSPGAKGDRGETGP | Collagen alpha-1(I) chain | Urine | 1829.8363 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10836 | DAGPAGPKGEPGSPGENGAPG | Collagen alpha-1(I) chain | Urine | 1866.8102 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10837 | DDGEAGKPGRPGERGPPGP | Collagen alpha-1(I) chain | Urine | 1877.8926 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10840 | SPGRDGSPGAKGDRGETGPA | Collagen alpha-1(I) chain | Urine | 1900.8687 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10842 | GDDGEAGKPGRPGERGPPGP | Collagen alpha-1(I) chain | Urine | 1934.8887 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10845 | GDDGEAGKPGRPGERGPPGP | Collagen alpha-1(I) chain | Urine | 1950.8771 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10852 | EGSPGRDGSPGAKGDRGETGP | Collagen alpha-1(I) chain | Urine | 2015.9013 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10856 | PPGEAGKPGEQGVPGDLGAPGP | Collagen alpha-1(I) chain | Urine | 2047.9459 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10857 | NGDDGEAGKPGRPGERGPPGP | Collagen alpha-1(I) chain | Urine | 2048.9342 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10859 | NGDDGEAGKPGRPGERGPPGP | Collagen alpha-1(I) chain | Urine | 2064.9331 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10862 | EGSPGRDGSPGAKGDRGETGPA | Collagen alpha-1(I) chain | Urine | 2086.9368 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10863 | GAPGNDGAKGDAGAPGAPGSQGAPG | Collagen alpha-1(I) chain | Urine | 2097.9094 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10865 | GPPGEAGKPGEQGVPGDLGAPGP | Collagen alpha-1(I) chain | Urine | 2104.972 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10867 | DGQPGAKGEPGDAGAKGDAGPPGP | Collagen alpha-1(I) chain | Urine | 2118.9623 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10868 | DGKTGPPGPAGQDGRPGPPGPPG | Collagen alpha-1(I) chain | Urine | 2129.9647 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10871 | DGQPGAKGEPGDAGAKGDAGPPGP | Collagen alpha-1(I) chain | Urine | 2134.9677 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10875 | DGQPGAKGEPGDAGAKGDAGPPGP | Collagen alpha-1(I) chain | Urine | 2150.9347 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10876 | PGDAGAKGDAGPPGPAGPAGPPGPIG | Collagen alpha-1(I) chain | Urine | 2151.0303 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10878 | NSGEPGAPGSKGDTGAKGEPGPVG | Collagen alpha-1(I) chain | Urine | 2154.9723 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10879 | AEGSPGRDGSPGAKGDRGETGPA | Collagen alpha-1(I) chain | Urine | 2157.9725 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10881 | AGPPGEAGKPGEQGVPGDLGAPGP | Collagen alpha-1(I) chain | Urine | 2160.0021 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10883 | NSGEPGAPGSKGDTGAKGEPGPVG | Collagen alpha-1(I) chain | Urine | 2170.9735 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10886 | AGPPGEAGKPGEQGVPGDLGAPGP | Collagen alpha-1(I) chain | Urine | 2176.0067 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10887 | ADGQPGAKGEPGDAGAKGDAGPPGP | Collagen alpha-1(I) chain | Urine | 2189.9958 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10889 | NGDDGEAGKPGRPGERGPPGPQ | Collagen alpha-1(I) chain | Urine | 2192.9891 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10891 | ADGQPGAKGEPGDAGAKGDAGPPGP | Collagen alpha-1(I) chain | Urine | 2206.0017 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10893 | NGAPGNDGAKGDAGAPGAPGSQGAPG | Collagen alpha-1(I) chain | Urine | 2211.9426 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10894 | ADGQPGAKGEPGDAGAKGDAGPPGP | Collagen alpha-1(I) chain | Urine | 2221.9847 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10895 | GNSGEPGAPGSKGDTGAKGEPGPVG | Collagen alpha-1(I) chain | Urine | 2227.9964 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10897 | NGDDGEAGKPGRPGERGPPGPQG | Collagen alpha-1(I) chain | Urine | 2234.0037 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10898 | GRTGDAGPVGPPGPPGPPGPPGPPS | Collagen alpha-1(I) chain | Urine | 2236.054 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10900 | GADGQPGAKGEPGDAGAKGDAGPPGP | Collagen alpha-1(I) chain | Urine | 2247.0131 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10902 | GADGQPGAKGEPGDAGAKGDAGPPGP | Collagen alpha-1(I) chain | Urine | 2263.014 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10905 | ADGQPGAKGEPGDAGAKGDAGPPGPA | Collagen alpha-1(I) chain | Urine | 2277.0228 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10906 | GADGQPGAKGEPGDAGAKGDAGPPGP | Collagen alpha-1(I) chain | Urine | 2279.0018 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10907 | ANGAPGNDGAKGDAGAPGAPGSQGAPG | Collagen alpha-1(I) chain | Urine | 2282.9953 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10909 | ADGQPGAKGEPGDAGAKGDAGPPGPA | Collagen alpha-1(I) chain | Urine | 2293.0049 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10910 | RTGDAGPVGPPGPPGPPGPPGPPSAG | Collagen alpha-1(I) chain | Urine | 2307.0867 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10913 | AGPPGEAGKPGEQGVPGDLGAPGPSG | Collagen alpha-1(I) chain | Urine | 2320.0655 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10916 | GADGQPGAKGEPGDAGAKGDAGPPGPA | Collagen alpha-1(I) chain | Urine | 2334.0496 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10917 | GANGAPGNDGAKGDAGAPGAPGSQGAPG | Collagen alpha-1(I) chain | Urine | 2340.023 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10918 | GADGQPGAKGEPGDAGAKGDAGPPGPA | Collagen alpha-1(I) chain | Urine | 2350.0263 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10919 | KGNSGEPGAPGSKGDTGAKGEPGPVG | Collagen alpha-1(I) chain | Urine | 2356.0992 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10920 | KNGDDGEAGKPGRPGERGPPGPQG | Collagen alpha-1(I) chain | Urine | 2362.0988 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10922 | GKNGDDGEAGKPGRPGERGPPGPQ | Collagen alpha-1(I) chain | Urine | 2378.0898 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10924 | LDGAKGDAGPAGPKGEPGSPGENGAPG | Collagen alpha-1(I) chain | Urine | 2408.0796 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10927 | LDGAKGDAGPAGPKGEPGSPGENGAPG | Collagen alpha-1(I) chain | Urine | 2424.0752 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10928 | ADGQPGAKGEPGDAGAKGDAGPPGPAGP | Collagen alpha-1(I) chain | Urine | 2431.0989 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10929 | PPGKNGDDGEAGKPGRPGERGPPGP | Collagen alpha-1(I) chain | Urine | 2444.1487 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10930 | TGPIGPPGPAGAPGDKGESGPSGPAGPTG | Collagen alpha-1(I) chain | Urine | 2472.148 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10932 | PPGESGREGAPGAEGSPGRDGSPGAKG | Collagen alpha-1(I) chain | Urine | 2482.1157 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10933 | GADGQPGAKGEPGDAGAKGDAGPPGPAGP | Collagen alpha-1(I) chain | Urine | 2488.1186 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10934 | PPGADGQPGAKGEPGDAGAKGDAGPPGP | Collagen alpha-1(I) chain | Urine | 2489.1067 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10935 | RGANGAPGNDGAKGDAGAPGAPGSQGAPG | Collagen alpha-1(I) chain | Urine | 2496.0978 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10936 | PPGESGREGAPGAEGSPGRDGSPGAKG | Collagen alpha-1(I) chain | Urine | 2498.1007 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10937 | GPPGKNGDDGEAGKPGRPGERGPPGP | Collagen alpha-1(I) chain | Urine | 2501.1697 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10938 | GADGQPGAKGEPGDAGAKGDAGPPGPAGP | Collagen alpha-1(I) chain | Urine | 2504.1284 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10940 | GPPGKNGDDGEAGKPGRPGERGPPGP | Collagen alpha-1(I) chain | Urine | 2517.1546 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10946 | GPPGADGQPGAKGEPGDAGAKGDAGPPGP | Collagen alpha-1(I) chain | Urine | 2546.1376 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10949 | PPGADGQPGAKGEPGDAGAKGDAGPPGPA | Collagen alpha-1(I) chain | Urine | 2560.1518 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10951 | AGPPGAPGAPGAPGPVGPAGKSGDRGETGP | Collagen alpha-1(I) chain | Urine | 2568.239 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10953 | AGPPGAPGAPGAPGPVGPAGKSGDRGETGP | Collagen alpha-1(I) chain | Urine | 2584.272 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10954 | PPGKNGDDGEAGKPGRPGERGPPGPQ | Collagen alpha-1(I) chain | Urine | 2588.208 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10955 | AGPPGAPGAPGAPGPVGPAGKSGDRGETGP | Collagen alpha-1(I) chain | Urine | 2600.223 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10956 | GPPGADGQPGAKGEPGDAGAKGDAGPPGPA | Collagen alpha-1(I) chain | Urine | 2617.1733 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10959 | GLPGPAGPPGEAGKPGEQGVPGDLGAPGP | Collagen alpha-1(I) chain | Urine | 2629.2181 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10960 | KEGGKGPRGETGPAGRPGEVGPPGPPGP | Collagen alpha-1(I) chain | Urine | 2640.2889 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10961 | KEGGKGPRGETGPAGRPGEVGPPGPPGP | Collagen alpha-1(I) chain | Urine | 2640.2997 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10964 | GPPGKNGDDGEAGKPGRPGERGPPGPQ | Collagen alpha-1(I) chain | Urine | 2645.2344 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10971 | KDGEAGAQGPPGPAGPAGERGEQGPAGSPG | Collagen alpha-1(I) chain | Urine | 2688.2119 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10973 | PPGADGQPGAKGEPGDAGAKGDAGPPGPAGP | Collagen alpha-1(I) chain | Urine | 2714.2168 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10978 | ERGSPGPAGPKGSPGEAGRPGEAGLPGAKG | Collagen alpha-1(I) chain | Urine | 2762.3302 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10979 | KEGGKGPRGETGPAGRPGEVGPPGPPGPAG | Collagen alpha-1(I) chain | Urine | 2768.3665 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10980 | GPPGADGQPGAKGEPGDAGAKGDAGPPGPAGP | Collagen alpha-1(I) chain | Urine | 2771.2373 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10981 | ERGSPGPAGPKGSPGEAGRPGEAGLPGAKG | Collagen alpha-1(I) chain | Urine | 2778.3258 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10985 | PPGPPGKNGDDGEAGKPGRPGERGPPGPQ | Collagen alpha-1(I) chain | Urine | 2855.2918 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10989 | GPPGPPGKNGDDGEAGKPGRPGERGPPGPQ | Collagen alpha-1(I) chain | Urine | 2912.3455 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10991 | RGPPGPPGKNGDDGEAGKPGRPGERGPPGP | Collagen alpha-1(I) chain | Urine | 2924.4042 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10993 | ESGREGAPGAEGSPGRDGSPGAKGDRGETGP | Collagen alpha-1(I) chain | Urine | 2927.3115 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10994 | ESGREGAPGAEGSPGRDGSPGAKGDRGETGP | Collagen alpha-1(I) chain | Urine | 2943.2682 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10995 | NVGAPGAKGARGSAGPPGATGFPGAAGRVGPPGP | Collagen alpha-1(I) chain | Urine | 2974.4763 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10996 | GESGREGAPGAEGSPGRDGSPGAKGDRGETGP | Collagen alpha-1(I) chain | Urine | 2984.3374 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10997 | GESGREGAPGAEGSPGRDGSPGAKGDRGETGP | Collagen alpha-1(I) chain | Urine | 3000.2871 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10998 | ESGREGAPGAEGSPGRDGSPGAKGDRGETGPA | Collagen alpha-1(I) chain | Urine | 3014.3608 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11004 | PPGESGREGAPGAEGSPGRDGSPGAKGDRGETGP | Collagen alpha-1(I) chain | Urine | 3210.4694 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11005 | PPGESGREGAPGAEGSPGRDGSPGAKGDRGETGP | Collagen alpha-1(I) chain | Urine | 3226.3807 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11010 | AAGEPGKAGERGVPGPPGAVGPAGKDGEAGAQGPPGP | Collagen alpha-1(I) chain | Urine | 3265.5702 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11011 | GPPGESGREGAPGAEGSPGRDGSPGAKGDRGETGP | Collagen alpha-1(I) chain | Urine | 3267.4917 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11014 | PPGESGREGAPGAEGSPGRDGSPGAKGDRGETGPA | Collagen alpha-1(I) chain | Urine | 3281.4884 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11018 | GPPGESGREGAPGAEGSPGRDGSPGAKGDRGETGPA | Collagen alpha-1(I) chain | Urine | 3338.5287 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11020 | PPGADGQPGAKGEPGDAGAKGDAGPPGPAGPAGPPGPIG | Collagen alpha-1(I) chain | Urine | 3376.5722 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11030 | ARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKGEAGPQGPRGSEGPQG | Collagen alpha-1(I) chain | Urine | 4253.0061 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |