Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID88 | HFFFPK | CLUSTERIN precursor | Serum | 822.41 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID89 | HFFFPKSRIV | CLUSTERIN precursor | Serum | 1277.71 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID90 | RPHFFFPKSRIV | CLUSTERIN precursor | Serum | 1530.86 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID1086 | HFFFPK | Clusterin precursor | Serum | 822.41 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.15, 4.66 and 0.76 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1087 | HFFFPKSRIV | Clusterin precursor | Serum | 1277.71 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =251, 1406 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID2025 | RPHFFFPK | Clusterin | Serum | 1074.57632 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2026 | FMETVAEKALQEYR | Clusterin | Serum | 1713.83961 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2027 | DQTVSDNELQEMSNQGSK | Clusterin | Serum | 2008.86438 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2028 | TLLSNLEEAK | Clusterin | Serum | 1116.60265 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2029 | FMETVAEKALQEY | Clusterin | Serum | 1557.7385 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2030 | TLIEKTNEER | Clusterin | Serum | 1231.64083 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID3173 | HFFFPK | Clusterin | Plasma | 821.4224 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3174 | HFFFPKS | Clusterin | Plasma | 908.4545 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3175 | FMETVAEK | Clusterin | Plasma | 953.4528 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3176 | RPHFFFPK | Clusterin | Plasma | 1074.5763 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3177 | TLLSNLEEAK | Clusterin | Plasma | 1116.6026 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3178 | RPHFFFPKS | Clusterin | Plasma | 1161.6084 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3179 | TLIEKTNEER | Clusterin | Plasma | 1231.6408 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3180 | TLLSNLEEAKK | Clusterin | Plasma | 1244.6976 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3181 | ASSIIDELFQDR | Clusterin | Plasma | 1392.6885 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3182 | FMETVAEKALQEY | Clusterin | Plasma | 1557.7385 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3183 | FMETVAEKALQEYR | Clusterin | Plasma | 1713.8396 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3184 | LRRELDESLQVAERLT | Clusterin | Plasma | 1927.0487 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3185 | DQTVSDNELQEMSNQGSKYVNK | Clusterin | Plasma | 2513.134 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3186 | ASSIIDELFQDRFFTREPQDT | Clusterin | Plasma | 2514.2027 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3187 | DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQI | Clusterin | Plasma | 3806.8381 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID4808 | FDSDPITVTVPVEVSRKNP | Isoform 1 of Clusterin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5399 | HTSDSDVPSGVTEVVVK | Isoform 1 of Clusterin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5472 | IHEAQQAMDIHFHSPAFQHPPTE | Isoform 1 of Clusterin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6437 | PSGVTEVVVKL | Isoform 1 of Clusterin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6782 | SDPITVTVPVEV | Isoform 1 of Clusterin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6925 | SHTSDSDVPSGVTEVVVK | Isoform 1 of Clusterin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6983 | SLLEQLNEQFNWV | Isoform 1 of Clusterin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7562 | TSDSDVPSGVTEVVVKL | Isoform 1 of Clusterin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8099 | VVVKLFDSDPITVTVPVE | Isoform 1 of Clusterin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8745 | DELFQDRFF | Isoform 1 of Clusterin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8770 | DQCDKCREILSVDCSTN | Isoform 1 of Clusterin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8771 | DQCDKCREILSVDCSTNNPS | Isoform 1 of Clusterin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8772 | DQTVSDNELQEM | Isoform 1 of Clusterin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9470 | RPHFFFPKSRIV | Clusterin | Plasma | 1530.86 | MALDI-TOF | Colorectal cancer | Lower intensity in liver metastasis than control groups and an opposite trend in adenoma and CRC group. | 26379225 |
| CancerPDF_ID10423 | VAEKALQEYRKKHREE | Clusterin | Urine | 2014.0714 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11567 | HFFFPKSRIV | Clusterin | Serum | 1276.7081 | LC-MS | Melanoma | "Present in 7 cancer samples out of 8 cancer samples. ,Present in 2 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID12715 | HFFFPK | Clusterin | Serum | 822.485 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.31 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.10, Upregulated in BC vs healthy with 1.029 fold change" | 27058005 |
| CancerPDF_ID12716 | FPKSRIV | Clusterin | Serum | 846.533 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.50 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.21, Upregulated in BC vs healthy with 1.139 fold change" | 27058005 |
| CancerPDF_ID12717 | HFFFPKSRIV | Clusterin | Serum | 1277.758 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.39 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.17, Upregulated in BC vs healthy with 1.117 fold change" | 27058005 |
| CancerPDF_ID12718 | RPHFFFPKSRIV | Clusterin | Serum | 1530.912 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.26 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.16, Upregulated in BC vs healthy with 1.106 fold change" | 27058005 |
| CancerPDF_ID14035 | TLLSNLEEAK | Clusterin | Plasma | 1117.611 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |