Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID1019 | LAEGGGVR | Fibrinopeptide A | Serum | 758.45 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.66, 0.95 and 0.65 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1020 | FLAEGGGVR | Fibrinopeptide A | Serum | 905.5 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "For bladder (Lower) and for breast (Higher) Differential ion intensity in cancer compare to normal with Ratio of median intensity (patients/Controls) = 0.97, 0.73 and 1.48 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1021 | DFLAEGGGVR | Fibrinopeptide A | Serum | 1020.47 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.28, 0.28 and 0.47 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1022 | GDFLAEGGGVR | Fibrinopeptide A | Serum | 1077.53 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.54, 0.5 and 0.97 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1023 | EGDFLAEGGGVR | Fibrinopeptide A | Serum | 1206.57 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.5, 0.44 and 0.69 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1024 | GEGDFLAEGGGVR | Fibrinopeptide A | Serum | 1263.6 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.2, 0.24 and 0.23 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1025 | SGEGDFLAEGGGVR | Fibrinopeptide A | Serum | 1350.64 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.47, 0.46 and 0.35 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1026 | DSGEGDFLAEGGGVR | Fibrinopeptide A | Serum | 1465.65 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.66, 0.55 and 0.8 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1027 | ADSGEGDFLAEGGGVR | Fibrinopeptide A | Serum | 1536.68 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.58, 0 and 0.54 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1028 | GSESGIFTNTKESSSHHPGIAEFPSRG | Fibrinogen alpha chain | Serum | 2816.25 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 68, 223 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1029 | SSSYSKQFTSSTSYNRGDSTFES | Fibrinogen alpha chain | Serum | 2553.01 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 1.35, 1.31 and 1.5 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1030 | SSSYSKQFTSSTSYNRGDSTFESKS | Fibrinogen alpha chain | Serum | 2768.3 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.77, 0.03 and 0.98 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1031 | SSSYSKQFTSSTSYNRGDSTFESKSY | Fibrinogen alpha chain | Serum | 2931.29 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in bladder cancer and upregulated in prostate cancer vs normal with Ratio of median intensity (patients/Controls) = 1.24, 0.13 and 0.97 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1032 | SSSYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha chain | Serum | 3190.4 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.52, 0 and 0.94 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1033 | SSSYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha chain | Serum | 3261.4 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.33, 0.08 and 0.74 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1034 | SSYSKQFTSSTSYNRGDSTFE | Fibrinogen alpha chain | Serum | 2379.03 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "For bladder (Lower) and for breast (Higher) Differential ion intensity in cancer compare to normal with Ratio of median intensity (patients/Controls) = 1.57, 0.22 and 1.71 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1035 | NA | Fibrinogen alpha chain | Serum | 3206.34 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1036 | NA | Fibrinogen alpha chain | Serum | 3277.39 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1037 | DEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Serum | 2659.03 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 1.37, 1.18 and 2.45 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1038 | SYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Serum | 3239.22 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1039 | HWESASLL | Complement C3f | Serum | 942.44 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "For Breast (Lower) and for Bladder (Higher) Differential ion intensity in cancer compare to normal with Ratio of median intensity (patients/Controls) = 1.74, 5.18 and 0.58 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1040 | IHWESASLL | Complement C3f | Serum | 1055.6 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 227, 1051 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1041 | RIHWESASLL | Complement C3f | Serum | 1211.7 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =7.86, 10.8 and 0.01 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1042 | HRIHWESASLL | Complement C3f | Serum | 1348.7 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1043 | THRIHWESASLL | Complement C3f | Serum | 1449.76 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "For Prostate & bladder (Higher) Differential ion intensity in cancer compare to normal with Ratio of median intensity (patients/Controls) =1885, 2646 and 437 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1044 | ITHRIHWESASLL | Complement C3f | Serum | 1562.84 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =0.79, 1.13 and 0.54 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1045 | KITHRIHWESASLL | Complement C3f | Serum | 1690.9 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "For Prostate & bladder (Higher) Differential ion intensity in cancer compare to normal with Ratio of median intensity (patients/Controls) =4.05, 6.85 and 1.01 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1046 | SKITHRIHWESASLL | Complement C3f | Serum | 1777.94 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "For Prostate & bladder (Higher) Differential ion intensity in cancer compare to normal with Ratio of median intensity (patients/Controls) =4.37, 7.7 and 0.96 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1047 | SSKITHRIHWESASLL | Complement C3f | Serum | 1864.95 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "For Prostate & bladder (Higher) and for breast (Lower) Differential ion intensity in cancer compare to normal with Ratio of median intensity (patients/Controls) =2.18, 3.33 and 0.3 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1048 | SSKITHRIHWESASLLR | Complement C3f | Serum | 2021.06 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1049 | SSKITHRIHWESASL | Complement C3f | Serum | 1751.88 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.82, 5.7 and 1.36 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1050 | NGFKSHALQLNNR | Complement C4 precursor | Serum | 1498.91 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1, 809 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1051 | NGFKSHALQLNNRQ | Complement C4 precursor | Serum | 1626.85 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.09, 0.88 and 2.78 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1052 | NGFKSHALQLNNRQI | Complement C4 precursor | Serum | 1739.93 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =0.75, 0.66 and 2.75 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1053 | NGFKSHALQLNNRQIR | Complement C4 precursor | Serum | 1895.99 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.27, 3.33 and 2.95 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1054 | GLEEELQFSLGSKINV | Complement C4 precursor | Serum | 1762.87 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "For bladder (Lower) and for breast (Higher) Differential ion intensity in cancer compare to normal with Ratio of median intensity (patients/Controls) =1.62, 0.01 and 3.16 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1055 | GLEEELQFSLGSKINVKVGGNS | Complement C4 precursor | Serum | 2305.2 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =3.75, 2.56 and 3.49 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1056 | GLEEELQFSLGSKINVKVGGNSKGTL | Complement C4 precursor | Serum | 2704.13 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =61, 49 and 133 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1057 | GLEEELQFSLGSKINVKVGGNSKGTLKVLR | Complement C4 precursor | Serum | 3200.52 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1058 | TLEIPGNSDPNMIPDGDFNSYVR | Complement C4 precursor | Serum | 2551.06 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1059 | HAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 842.4 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in Prostate cancer vs normal,Downregulated in Bladder cancer vs normal with Ratio of median intensity (patients/Controls) =1.49, 0.01 and 1.04 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1060 | GLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 1786.86 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =2.39, 2.88 and 2.3 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1061 | QLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H6 | Serum | 2028.01 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1062 | SRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H7 | Serum | 2271.14 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =4.58, 2.64 and 1.46 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1063 | SSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H8 | Serum | 2358.09 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =100, 73 and 531 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1064 | GVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H9 | Serum | 2627.48 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =2.24, 0.26 and 1.07 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1065 | PGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H10 | Serum | 2724.48 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.75, 6.17 and 1.64 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1066 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H11 | Serum | 3272.5 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1, 1277 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1067 | QAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H12 | Serum | 3970.97 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1, 957 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1068 | QLGLPGPPDVPDHAAYHPFR | Inter-alpha-trypsin inhibitor heavy chain H13 | Serum | 2183.91 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.71, 1.79 and 2.83 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1069 | HAAYHPFR | Inter-alpha-trypsin inhibitor heavy chain H14 | Serum | 998.45 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =121, 256 and 147 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1070 | NVHSGSTFFKYYLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H15 | Serum | 3156.52 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =3.43, 10.68 and 1.33 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1071 | NVHSAGAAGSRMNFRPGVLSS | PRO1851(ITIH4 splice variant) | Serum | 2115.01 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =3.22, 12.23 and 10.61 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1072 | ATEHLSTLSEKAKPALEDL | Apolipoprotein A-I | Serum | 2052.89 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =105, 306 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1073 | QGLLPVLESFKVSFLSALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 3182.46 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =0.74, 6.36 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1074 | VSFLSALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 1971.16 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1, 641 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1075 | ELQEGARQKLHELQE | Apolipoprotein A-I | Serum | 1807.78 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1076 | AELQEGARQKLHELQEKLSPLGEEMRDRA | Apolipoprotein A-I | Serum | 3377.45 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1077 | ISASAEELRQRLAPLAEDVRGNL | Apolipoprotein A-IV | Serum | 2508.16 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.38, 1.2 and 7.96 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1078 | SLAELGGHLDQQVEEF | Apolipoprotein A-IV | Serum | 1771.81 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =148, 220 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1079 | GNTEGLQKSLAELGGHLDQQVEEF | Apolipoprotein A-IV | Serum | 2599.18 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1080 | GNTEGLQKSLAELGGHLDQQVEEFR | Apolipoprotein A-IV | Serum | 2755.2 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.11, 12.37 and 1.22 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1081 | SLAELGGHLDQQVEEFR | Apolipoprotein A-IV | Serum | 1927.94 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =79, 671 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1082 | DVSSALDKLKEFGNTLEDKARELIS | Apolipoprotein C-I | Serum | 2778.15 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1083 | TVGSLAGQPLQERAQAWGERL | Apolipoprotein E | Serum | 2267.07 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1084 | AATVGSLAGQPLQERAQAWGERL | Apolipoprotein E | Serum | 2409.13 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =97, 2124 and 109 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1085 | AATVGSLAGQPLQERAQAWGERLR | Apolipoprotein E | Serum | 2565.45 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1, 902 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1086 | HFFFPK | Clusterin precursor | Serum | 822.41 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.15, 4.66 and 0.76 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1087 | HFFFPKSRIV | Clusterin precursor | Serum | 1277.71 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =251, 1406 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1088 | RPPGFSPF | Bradykinin (and des-Arg bradykinin) | Serum | 904.48 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "For bladder (Lower) and for breast (Higher) Differential ion intensity in cancer compare to normal with Ratio of median intensity (patients/Controls) =1.06, 0.79 and 1.62 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1089 | RPPGFSPFR | Bradykinin (and des-Arg bradykinin) | Serum | 1060.57 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "For bladder (Lower) and for breast (Higher) Differential ion intensity in cancer compare to normal with Ratio of median intensity (patients/Controls) =0.77, 0.43 and 1.9 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1090 | NA | Bradykinin (and des-Arg bradykinin) | Serum | 920.41 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1091 | NA | Bradykinin (and des-Arg bradykinin) | Serum | 1076.53 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1092 | NLGHGHKHERDQGHGHQ | HMW Kininogen | Serum | 1943.88 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.58, 141 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1093 | KHNLGHGHKHERDQGHGHQ | HMW Kininogen | Serum | 2209.08 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.72, 2.07 and 1.56 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1094 | GHGLGHGHEQQHGLGHGHKF | HMW Kininogen | Serum | 2126.94 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1095 | AVPPNNSNAAEDDLPTVELQGVVPR | Factor XIIIa | Serum | 2602.15 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =2.84, 2.3 and 4.73 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1096 | ALGISPFHEHAEVVFTANDSGPR | Transtherin precursor (‘prealbumin’) | Serum | 2451.11 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =0.02, 1.17 and 3.07 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1097 | PDAPRIKKIVQKKLAGDESAD | Platelet basic protein Precursor | Serum | 2279.18 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID3401 | SWGGRPQRMGAVPGGVWSAVLMGGAR | Receptor tyrosine-protein kinase erbB-2 | Plasma | NA | Linear ion-trap mass spectrometer (LTQ) coupled with a Surveyor HPLC-MS | Breast cancer | Differentially expressed between normal and patients | 24565027 |
| CancerPDF_ID3402 | QTPKHISESLGAEVDPDMSWSSSLATPPTLSSTVLIGLLHSSVK | Breast cancer type 2 susceptibility protein | Plasma | NA | Linear ion-trap mass spectrometer (LTQ) coupled with a Surveyor HPLC-MS | Breast cancer | Differentially expressed between normal and patients | 24565027 |
| CancerPDF_ID3403 | SLWLQSQPHFCCFWLTVTFPPPLQTHRELAQSSHAQR | NT-3 growth factor receptor | Plasma | NA | Linear ion-trap mass spectrometer (LTQ) coupled with a Surveyor HPLC-MS | Breast cancer | Differentially expressed between normal and patients | 24565027 |
| CancerPDF_ID3404 | WGLLLALLPPGAASTQAVWTWMTR | Receptor tyrosine-protein kinase erbB-2 | Plasma | NA | Linear ion-trap mass spectrometer (LTQ) coupled with a Surveyor HPLC-MS | Breast cancer | Differentially expressed between normal and patients | 24565027 |
| CancerPDF_ID3405 | LSWNHVARALTLTQSLVSSVTSGK | NT-3 growth factor receptor | Plasma | NA | Linear ion-trap mass spectrometer (LTQ) coupled with a Surveyor HPLC-MS | Breast cancer | Differentially expressed between normal and patients | 24565027 |
| CancerPDF_ID3406 | CQGEPYHDIRFNLMAVVPDR | Ubiquitin carboxyl-terminal hydrolase BAP1 | Plasma | NA | Linear ion-trap mass spectrometer (LTQ) coupled with a Surveyor HPLC-MS | Breast cancer | Differentially expressed between normal and patients | 24565027 |
| CancerPDF_ID3407 | QVLPVGVLGPPGQQAPPPYPGPHPAGPPVIQQPTTPMFVAPPPK | Protein polybromo-1 | Plasma | NA | Linear ion-trap mass spectrometer (LTQ) coupled with a Surveyor HPLC-MS | Breast cancer | Differentially expressed between normal and patients | 24565027 |
| CancerPDF_ID3408 | DHLACWDYDLCITCYNTKNHDHK | Histone acetyltransferase p300 | Plasma | NA | Linear ion-trap mass spectrometer (LTQ) coupled with a Surveyor HPLC-MS | Breast cancer | Differentially expressed between normal and patients | 24565027 |
| CancerPDF_ID8413 | NA | NA | Serum | 1933.52 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 42.86% ; In Rectal cancer : 19.44% ; Breast cancer: 0%; In normal healthy individuals : 97.2% | 23667664 |
| CancerPDF_ID8414 | NA | NA | Serum | 2210.34 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | "Frequency of peptide Breast cancer: 77%, In lung cancer :78.57% ; In Rectal cancer : 86.11% ; In normal healthy individuals : 97.2%" | 23667664 |
| CancerPDF_ID8415 | NA | NA | Serum | 2933.03 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 81.43% ; In Rectal cancer : 97.22% ; Breast cancer: 89%; In normal healthy individuals : 97% | 23667664 |
| CancerPDF_ID8416 | NA | NA | Serum | 7740.77 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 85.71% ; In Rectal cancer : 97.22% ; Breast cancer: 98%; In normal healthy individuals : 95.2% | 23667664 |
| CancerPDF_ID8417 | NA | NA | Serum | 4617.02 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 88.57% ; In Rectal cancer : 94.44% ; Breast cancer: 93%; In normal healthy individuals : 94.2% | 23667664 |
| CancerPDF_ID8418 | NA | NA | Serum | 4144.83 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 85.71% ; In Rectal cancer : 94.44% ; Breast cancer: 93%; In normal healthy individuals : 92.4% | 23667664 |
| CancerPDF_ID8419 | NA | NA | Serum | 6412.9 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 92.86% ; In Rectal cancer : 97.22% ; Breast cancer: 97%; In normal healthy individuals : 91% | 23667664 |
| CancerPDF_ID8420 | NA | NA | Serum | 3891.63 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 45.71% ; In Rectal cancer : 33.33% ; Breast cancer: 62%; In normal healthy individuals : 88.2% | 23667664 |
| CancerPDF_ID8421 | NA | NA | Serum | 4455.33 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 81.43% ; In Rectal cancer : 88.89% ; Breast cancer: 67%; In normal healthy individuals : 86.2% | 23667664 |
| CancerPDF_ID8422 | NA | NA | Serum | 4269.96 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 72.86% ; In Rectal cancer : 69.44% ; Breast cancer: 78%; In normal healthy individuals : 82.4% | 23667664 |
| CancerPDF_ID8423 | NA | NA | Serum | 8901.56 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 97.14% ; In Rectal cancer : 97.22% ; Breast cancer: 100%; In normal healthy individuals : 81.2% | 23667664 |
| CancerPDF_ID8424 | SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha | Serum | 5905.24 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 78.57% ; In Rectal cancer : 86.11% ; Breast cancer: 72%; In normal healthy individuals : 80.6% | 23667664 |
| CancerPDF_ID8425 | NA | NA | Serum | 3152.18 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 52.85% ; In Rectal cancer : 61.11% ; Breast cancer: 43%; In normal healthy individuals : 79.8% | 23667664 |
| CancerPDF_ID8426 | NA | NA | Serum | 3212.45 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 62.86% ; In Rectal cancer : 86.11% ; Breast cancer: 72%; In normal healthy individuals : 79.2% | 23667664 |
| CancerPDF_ID8427 | NA | NA | Serum | 2068.72 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 5.71% ; In Rectal cancer : 22.22% ; Breast cancer: 1%; In normal healthy individuals : 78.80% | 23667664 |
| CancerPDF_ID8428 | NA | NA | Serum | 3362.65 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 81.43% ; In Rectal cancer : 91.67% ; Breast cancer: 72%; In normal healthy individuals : 77.4% | 23667664 |
| CancerPDF_ID8429 | NA | NA | Serum | 2266.53 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 58.57% ; In Rectal cancer : 66.67% ; Breast cancer: 70%; In normal healthy individuals : 76.6% | 23667664 |
| CancerPDF_ID8430 | NA | NA | Serum | 8097 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 91.43% ; In Rectal cancer : 86.11% ; Breast cancer: 97%; In normal healthy individuals : 72.2% | 23667664 |
| CancerPDF_ID8431 | NA | NA | Serum | 3434.65 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 84.29% ; In Rectal cancer : 86.11% ; Breast cancer: 77%; In normal healthy individuals :72% | 23667664 |
| CancerPDF_ID8432 | NA | NA | Serum | 3948.85 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 41.43% ; In Rectal cancer : 41.67% ; Breast cancer: 48%; In normal healthy individuals : 71% | 23667664 |
| CancerPDF_ID8433 | NA | NA | Serum | 4130.82 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 42.86% ; In Rectal cancer : 63.89% ; Breast cancer: 49%; In normal healthy individuals : 70.6% | 23667664 |
| CancerPDF_ID8434 | NA | NA | Serum | 2769.85 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 38.57% ; In Rectal cancer : 58.33% ; Breast cancer: 50%; In normal healthy individuals : 70.20% | 23667664 |
| CancerPDF_ID8435 | NA | NA | Serum | 2545.69 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 70% ; In Rectal cancer : 69.44% ; Breast cancer: 59%; In normal healthy individuals : 68% | 23667664 |
| CancerPDF_ID8436 | NA | NA | Serum | 4279.75 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 44.29% ; In Rectal cancer : 33.33% ; Breast cancer: 57%; In normal healthy individuals : 68% | 23667664 |
| CancerPDF_ID8437 | NA | NA | Serum | 1998.39 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In normal healthy individuals : 66.2% | 23667664 |
| CancerPDF_ID8438 | NA | NA | Serum | 3302.32 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 92.86% ; In Rectal cancer : 97.22% ; Breast cancer: 95%; In normal healthy individuals : 65% | 23667664 |
| CancerPDF_ID8439 | NA | NA | Serum | 4626.49 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 30% ; In Rectal cancer : 55.56% ; Breast cancer: 29%; In normal healthy individuals : 64.60% | 23667664 |
| CancerPDF_ID8440 | NA | NA | Serum | 9223.32 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 81.43% ; In Rectal cancer : 75% ; Breast cancer: 70%; In normal healthy individuals : 60.60% | 23667664 |
| CancerPDF_ID8441 | NA | NA | Serum | 2660.78 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 60% ; In Rectal cancer : 88.89% ; Breast cancer: 80%; In normal healthy individuals : 58.20% | 23667664 |
| CancerPDF_ID8442 | NA | NA | Serum | 13780.5 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 52.86% ; In Rectal cancer : 50% ; Breast cancer: 60%; In normal healthy individuals : 58.2% | 23667664 |
| CancerPDF_ID8443 | NA | NA | Serum | 3810.31 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer :35.71% ; In Rectal cancer : 50% ; Breast cancer: 32%; In normal healthy individuals : 57.6% | 23667664 |
| CancerPDF_ID8444 | NA | NA | Serum | 6626.75 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 98.57% ; In Rectal cancer : 97.22% ; Breast cancer: 98%; In normal healthy individuals : 55% | 23667664 |
| CancerPDF_ID8445 | NA | NA | Serum | 4160.55 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 34.29% ; In Rectal cancer : 16.67% ; Breast cancer: 37%; In normal healthy individuals :53.2% | 23667664 |
| CancerPDF_ID8446 | NA | NA | Serum | 6936.01 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 2.86% ; In Rectal cancer : 61.11% ; Breast cancer: 10%; In normal healthy individuals : 52% | 23667664 |
| CancerPDF_ID8447 | NA | NA | Serum | 2012.39 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 75.71% ; In Rectal cancer : 72.22% ; Breast cancer: 87%; In normal healthy individuals :49.4% | 23667664 |
| CancerPDF_ID8448 | NA | NA | Serum | 2597.36 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 11.43% ; In Rectal cancer : 22.22% ; Breast cancer: 59%; In normal healthy individuals : 48.8% | 23667664 |
| CancerPDF_ID8449 | NA | NA | Serum | 3184.7 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 7.14% ; In Rectal cancer : 50% ; Breast cancer: 30%; In normal healthy individuals : 48.4% | 23667664 |
| CancerPDF_ID8450 | NA | NA | Serum | 3872.19 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 42.86% ; In Rectal cancer : 75% ; Breast cancer: 45%; In normal healthy individuals : 48.2% | 23667664 |
| CancerPDF_ID8451 | NA | NA | Serum | 2082.73 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 5.71% ; In Rectal cancer : 19.44% ; Breast cancer: 67%; In normal healthy individuals : 47.2% | 23667664 |
| CancerPDF_ID8452 | NA | NA | Serum | 4786.97 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 51.43% ; In Rectal cancer : 77.78% ; Breast cancer: 58%; In normal healthy individuals : 45.20% | 23667664 |
| CancerPDF_ID8453 | NA | NA | Serum | 6526.74 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide in normal healthy : 45.2% | 23667664 |
| CancerPDF_ID8454 | NA | NA | Serum | 3254.85 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 24.29% ; In Rectal cancer : 44.44% ; Breast cancer: 21%; In normal healthy individuals : 41.8% | 23667664 |
| CancerPDF_ID8455 | NA | NA | Serum | 3316.32 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 92.86% ; In Rectal cancer : 97.22% ; Breast cancer: 95%; In normal healthy individuals : 40.6% | 23667664 |
| CancerPDF_ID8456 | NA | NA | Serum | 2863.06 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 78.57% ; In Rectal cancer : 83.33% ; Breast cancer: 80%; In normal healthy individuals : 39% | 23667664 |
| CancerPDF_ID8457 | NA | NA | Serum | 4207.72 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 25.71% ; In Rectal cancer : 38.89% ; Breast cancer: 26%; In normal healthy individuals : 37.8% | 23667664 |
| CancerPDF_ID8458 | NA | NA | Serum | 4175.84 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 24.29% ; In Rectal cancer : 27.78% ; Breast cancer: 41%; In normal healthy individuals : 37.6% | 23667664 |
| CancerPDF_ID8459 | NA | NA | Serum | 2944.24 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer :44.29% ; In Rectal cancer : 55.56% ; Breast cancer: 37%; In normal healthy individuals : 34.6% | 23667664 |
| CancerPDF_ID8460 | NA | NA | Serum | 3479.93 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 52.86% ; In Rectal cancer : 58.33% ; Breast cancer: 44%; In normal healthy individuals :34.2% | 23667664 |
| CancerPDF_ID8461 | NA | NA | Serum | 1856.94 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide in normal healthy : 32.80% | 23667664 |
| CancerPDF_ID8462 | NA | NA | Serum | 3226.75 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 1.43% ; In Rectal cancer : 2.78% ; Breast cancer: 3%; In normal healthy individuals : 32.6% | 23667664 |
| CancerPDF_ID8463 | NA | NA | Serum | 4342.03 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 40% ; In Rectal cancer : 50% ; Breast cancer: 32%; In normal healthy individuals : 28.8% | 23667664 |
| CancerPDF_ID8464 | NA | NA | Serum | 4121.95 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 14.29% ; In Rectal cancer : 16.67% ; Breast cancer: 15%; In normal healthy individuals : 28.8% | 23667664 |
| CancerPDF_ID8465 | NA | NA | Serum | 4193.63 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 8.57% ; In Rectal cancer : 8.33% ; Breast cancer: 16%; In normal healthy individuals : 28.8% | 23667664 |
| CancerPDF_ID8466 | NA | NA | Serum | 4529.82 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 4.29% ; In Rectal cancer : 41.67% ; Breast cancer: 28%; In normal healthy individuals : 26.2% | 23667664 |
| CancerPDF_ID8467 | NA | NA | Serum | 3241.49 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 88.57% ; In Rectal cancer : 86.11% ; Breast cancer: 83%; In normal healthy individuals : 25.6% | 23667664 |
| CancerPDF_ID8468 | NA | NA | Serum | 2124.16 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 10% ; In Rectal cancer : 11.11% ; Breast cancer: 8%; In normal healthy individuals : 25.6% | 23667664 |
| CancerPDF_ID8469 | NA | NA | Serum | 4237.35 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 0% ; In Rectal cancer : 19.44% ; Breast cancer: 14%; In normal healthy individuals : 25.6% | 23667664 |
| CancerPDF_ID8470 | NA | NA | Serum | 1463.76 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 40% ; In Rectal cancer : 58.33% ; Breast cancer: 26%; In normal healthy individuals :25.20% | 23667664 |
| CancerPDF_ID8471 | NA | NA | Serum | 3274.73 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 21.43% ; In Rectal cancer : 16.67% ; Breast cancer: 23%; In normal healthy individuals : 25% | 23667664 |
| CancerPDF_ID8472 | NA | NA | Serum | 3962.94 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 2.86% ; In Rectal cancer : 8.33% ; Breast cancer:3%; In normal healthy individuals : 24% | 23667664 |
| CancerPDF_ID8473 | NA | NA | Serum | 6836.01 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 57.14% ; In Rectal cancer : 0% ; Breast cancer: 71%; In normal healthy individuals : 23.6% | 23667664 |
| CancerPDF_ID8474 | NA | NA | Serum | 1779.05 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 7.14% ; In Rectal cancer : 27.78% ; Breast cancer: 11%; In normal healthy individuals : 23% | 23667664 |
| CancerPDF_ID8475 | NA | NA | Serum | 5319.96 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide in normal healthy : 23% | 23667664 |
| CancerPDF_ID8476 | NA | NA | Serum | 1947.61 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide in normal healthy : 21.20% | 23667664 |
| CancerPDF_ID8477 | NA | NA | Serum | 2379.64 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 14.20% ; In Rectal cancer : 19.44% ; Breast cancer: 4%; In normal healthy individuals : 20.6% | 23667664 |
| CancerPDF_ID8478 | NA | NA | Serum | 2075.72 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | "Frequency of peptide in lung cancer : 97.2% , In normal healthy individuals : 0%" | 23667664 |
| CancerPDF_ID8479 | NA | NA | Serum | 4069 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | "Frequency of peptide in lung cancer : 65.7% , In normal healthy individuals : 5.6%" | 23667664 |
| CancerPDF_ID8480 | NA | NA | Serum | 2652 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | "Frequency of peptide in lung cancer : 65.7% , In normal healthy individuals : 2.8%" | 23667664 |
| CancerPDF_ID8481 | NA | NA | Serum | 1787.97 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | "Frequency of peptide in lung cancer : 55.7% , In normal healthy individuals : 0.6%" | 23667664 |
| CancerPDF_ID8482 | NA | NA | Serum | 1945.03 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | "Frequency of peptide Breast cancer:99%, In lung cancer : 48.57% ; In Rectal cancer : 75% ; In normal healthy individuals : 0.4%" | 23667664 |
| CancerPDF_ID8483 | NA | NA | Serum | 2673.8 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide in lung cancer : 41.42% ; In breast cancer :42%; In normal healthy individuals : 6% | 23667664 |
| CancerPDF_ID8484 | NA | NA | Serum | 2991.23 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide Breast cancer: 29%; In lung cancer : 38.57% ; In Rectal cancer: 38.89%; In normal healthy individuals : 1.8% | 23667664 |
| CancerPDF_ID8485 | NA | NA | Serum | 1349.53 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide in lung cancer : 30% ; In Rectal cancer:58.33%; In normal healthy individuals : 8% | 23667664 |
| CancerPDF_ID8486 | NA | NA | Serum | 5000.21 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide in lung cancer : 30% ; In breast cancer: 37%; In normal healthy individuals : 7% | 23667664 |
| CancerPDF_ID8487 | NA | NA | Serum | 2976.33 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | "Frequency of peptide in lungcancer : 28.57% , In normal healthy individuals : 5.4%" | 23667664 |
| CancerPDF_ID8488 | NA | NA | Serum | 5282.44 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | "Frequency of peptide in rectal cancer : 66.67% , In normal healthy individuals : 1.2%" | 23667664 |
| CancerPDF_ID8489 | NA | NA | Serum | 4057.96 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | "Frequency of peptide in rectal cancer : 58.33% , In normal healthy individuals : 15.6%" | 23667664 |
| CancerPDF_ID8490 | NA | NA | Serum | 1207.29 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | "Frequency of peptide in rectal cancer : 52.787% , In normal healthy individuals : 10.6%" | 23667664 |
| CancerPDF_ID8491 | NA | NA | Serum | 4952.82 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | "Frequency of peptide in rectal cancer :50% , In normal healthy individuals : 7.2%" | 23667664 |
| CancerPDF_ID8492 | NA | NA | Serum | 2233.27 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | "Frequency of peptide in rectal cancer : 44.44% , In normal healthy individuals : 3.2%" | 23667664 |
| CancerPDF_ID8493 | NA | NA | Serum | 7458.63 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | "Frequency of peptide in rectal cancer : 41.67% , In normal healthy individuals : 5.2%" | 23667664 |
| CancerPDF_ID8494 | NA | NA | Serum | 2312.22 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | "Frequency of peptide in rectal cancer : 36.11% , In normal healthy individuals : 10%" | 23667664 |
| CancerPDF_ID8495 | NA | NA | Serum | 4468.34 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | "Frequency of peptide in breast cancer : 95% , In normal healthy individuals : 2.6%" | 23667664 |
| CancerPDF_ID8496 | NA | NA | Serum | 4057.96 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | "Frequency of peptide in breast cancer : 68% , In normal healthy individuals :1 5.6%" | 23667664 |
| CancerPDF_ID8497 | NA | NA | Serum | 5291.71 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | "Frequency of peptide in breast cancer : 64% , In normal healthy individuals : 0.4%" | 23667664 |
| CancerPDF_ID8498 | NA | NA | Serum | 1787.97 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | "Frequency of peptide in breast cancer :60% , In normal healthy individuals : 2%" | 23667664 |
| CancerPDF_ID8499 | NA | NA | Serum | 2726.07 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | "Frequency of peptide in breat cancer : 39% , In normal healthy individuals :6.60%" | 23667664 |
| CancerPDF_ID8500 | NA | NA | Serum | 2452.69 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | "Frequency of peptide in breast cancer : 28% , In normal healthy individuals : 1.2%" | 23667664 |
| CancerPDF_ID8501 | ADSGEGDFLAEGGGVR | Fibrinogen alpha | Serum | 1535.69 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8502 | DSGEGDFLAEGGGVR | Fibrinogen alpha | Serum | 1464.65 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8503 | SGEGDFLAEGGGVR | Fibrinogen alpha | Serum | 1349.62 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8504 | GEGDFLAEGGGVR | Fibrinogen alpha | Serum | 1262.59 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8505 | EGDFLAEGGGVR | Fibrinogen alpha | Serum | 1205.57 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8506 | GDFLAEGGGVR | Fibrinogen alpha | Serum | 1076.53 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8507 | DFLAEGGGVR | Fibrinogen alpha | Serum | 1019.5 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8508 | DSGEGDFLAEGGGV | Fibrinogen alpha | Serum | 1308.55 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8509 | SGEGDFLAEGGGV | Fibrinogen alpha | Serum | 1193.52 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8510 | GDFLAEGGGV | Fibrinogen alpha | Serum | 920.42 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8511 | DFLAEGGGV | Fibrinogen alpha | Serum | 863.4 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8512 | FLAEGGGV | Fibrinogen alpha | Serum | 748.38 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8513 | FLAEGGG | Fibrinogen alpha | Serum | 649.31 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8514 | DFLAEGG | Fibrinogen alpha | Serum | 707.31 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8515 | NRGDSTFESKSY | Fibrinogen alpha | Serum | 1389.62 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8516 | SSSYSKQFTSSTSYNRGDSTFES | Fibrinogen alpha | Serum | 2552.09 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8517 | SSSYSKQFTSSTSYNRGDSTFESKS | Fibrinogen alpha | Serum | 2767.22 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8518 | SSSYSKQFTSSTSYNRGDSTFESKSY | Fibrinogen alpha | Serum | 2930.28 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8519 | SSSYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha | Serum | 3189.42 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8520 | SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHGTHSTK | Fibrinogen alpha | Serum | 4783.09 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8521 | SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHGTHSTKRG | Fibrinogen alpha | Serum | 4996.21 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8522 | SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHA | Fibrinogen alpha | Serum | 5333.35 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8523 | SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha | Serum | 5900.7 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8524 | GDSTFESKSYKMADEAGSEADHEGTHSTKRGHA | Fibrinogen alpha | Serum | 3522.53 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8525 | SYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha | Serum | 3238.52 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8526 | SYKMADEAGSEADHEGTHSTKRGHA | Fibrinogen alpha | Serum | 2671.17 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8527 | SYKMADEAGSEADHEGTHSTK | Fibrinogen alpha | Serum | 2249.95 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8528 | SYKMADEAGSEADHEGTHST | Fibrinogen alpha | Serum | 2121.85 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8529 | KMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha | Serum | 2988.42 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8530 | MADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha | Serum | 2874.34 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8531 | MADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha | Serum | 2860.33 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8532 | MADEAGSEADHEGTHSTKRGHAKSRP | Fibrinogen alpha | Serum | 2761.26 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8533 | MADEAGSEADHEGTHSTKRGHA | Fibrinogen alpha | Serum | 2292.98 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8534 | ADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha | Serum | 2729.29 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8535 | ADEAGSEADHEGTHSTKRGHA | Fibrinogen alpha | Serum | 2161.94 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8536 | DEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha | Serum | 2658.25 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8537 | DEAGSEADHEGTHSTKRGHAKSRP | Fibrinogen alpha | Serum | 2559.18 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8538 | DEAGSEADHEGTHSTKRGHA | Fibrinogen alpha | Serum | 2090.9 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8539 | DEAGSEADHEGTHSTKRGH | Fibrinogen alpha | Serum | 2019.86 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8540 | DEAGSEADHEGTHSTKRG | Fibrinogen alpha | Serum | 1882.8 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8541 | EAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha | Serum | 2543.22 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8542 | GSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha | Serum | 2343.14 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8543 | GSESGIFTNTKESSSHHPGIAEFPSRG | Fibrinogen alpha | Serum | 2815.32 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8544 | SSKITHRIHWESASLLR | Complement C3f | Serum | 2020.1 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8545 | SKITHRIHWE | Complement C3f | Serum | 1305.69 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8546 | SKITHRIHWESASLL | Complement C3f | Serum | 1776.96 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8547 | KITHRIHWESASLL | Complement C3f | Serum | 1689.93 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8548 | THRIHWESASLL | Complement C3f | Serum | 1448.75 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8549 | THRIHWE | Complement C3f | Serum | 977.48 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8550 | HRIHWESASLL | Complement C3f | Serum | 1347.7 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8551 | IHWESASLL | Complement C3f | Serum | 1054.54 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8552 | HWESASLL | Complement C3f | Serum | 941.46 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8553 | HWESASLL | Complement C3f | Serum | 955.48 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8554 | HWESASL | Complement C3f | Serum | 828.38 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8555 | ASHLGLA | Complement C3f | Serum | 667.37 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8556 | SEETKENEGFTVTAEGK | Complement C3f | Serum | 1854.85 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8557 | RNGFKSHALQLNNRQI | Complement C3f | Serum | 1895.02 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8558 | NGFKSHALQLNNR | Complement C3f | Serum | 1497.78 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8559 | SHALQLNN | Complement C3f | Serum | 895.45 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8560 | GLEEELQFSLGSKINVKVGGNSKGTLKVLR | Complement C3f | Serum | 3199.79 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8561 | GLEEELQFSLGSKINVKVGGNSKGTL | Complement C3f | Serum | 2703.44 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8562 | GLEEELQFSLGSKINVKVGGNS | Complement C3f | Serum | 2304.2 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8563 | DDPDAPLQPVTPLQLFEGRRN | Complement C3f | Serum | 2377.2 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8564 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 3271.63 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8565 | PGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 2723.38 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8566 | GVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 2626.33 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8567 | SSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 2357.16 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8568 | QLGLPGPPDVPDHAAYHPFR | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 2183.09 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8569 | QLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 2026.99 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8570 | GLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1785.85 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8571 | GLPGPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1170.57 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8572 | GLPGPPDVPDH | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1099.53 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8573 | PGPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1000.46 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8574 | GPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 903.41 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8575 | GPPDVPDH | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 832.37 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8576 | NVHSGSTFFKYYLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 3155.62 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8577 | GSEMVVAGKLQDR | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1388.71 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8578 | AELQEGARQKLHELQEKLSPLGEEMRDRA | Aplipoprotein A-I | Serum | 3374.74 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8579 | QGLLPVLESFKVSFLSALEEYTKKLNTQ | Aplipoprotein A-I | Serum | 3181.73 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8580 | ATEHLSTLSEKAKPALEDL | Aplipoprotein A-I | Serum | 2052.07 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8581 | ISASAEELRQRLAPLAEDVRGNL | Aplipoprotein A-IV | Serum | 2507.35 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8582 | GNTEGLQKSLAELGGHLDQQVEEFR | Aplipoprotein A-IV | Serum | 2754.36 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8583 | KHNLGHGHKHERDQGHGHQ | Kininogen HMW | Serum | 2208.05 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8584 | NLGHGHKHERDQGHGHQ | Kininogen HMW | Serum | 1942.9 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8585 | GHGLGHGHEQQHGLGHGHKF | Kininogen HMW | Serum | 2126.01 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8586 | ALGISPFHEHAEVVFTANDSGPR | Transthyretin | Serum | 2450.2 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8587 | DSGPRRYTIAALLSPYSYSTTAVVTNPKE | Transthyretin | Serum | 3156.61 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8588 | ALLSPYSYSTTAVVTNPKE | Transthyretin | Serum | 2040.04 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8589 | SYSTTAVVTNPKE | Transthyretin | Serum | 1395.69 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8590 | SYSTTAVVTNPKE | Transthyretin | Serum | 1409.7 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8591 | SALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPKQA | Antichymotrypsin | Serum | 4622.49 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8592 | LVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPKQA | Antichymotrypsin | Serum | 4464.42 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8593 | VETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPKQA | Antichymotrypsin | Serum | 4351.33 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8594 | LMIIVPTDTQNIFFMSKVTNPKQA | Antichymotrypsin | Serum | 2735.44 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8595 | IIVPTDTQNIFFMSKVTNPKQA | Antichymotrypsin | Serum | 2491.31 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8596 | LEAIPMSIPPEVKFNKPFVFLMIDQNTKSPLFMGKVVNPTQK | Alpha-1 antitrypsin | Serum | 4772.55 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8597 | SIPPEVKFNKPFVFLMIDQNTKSPLFMGKVVNPTQK | Alpha-1 antitrypsin | Serum | 4118.21 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8598 | LMIDQNTKSPLFMGKVVNPTQK | Alpha-1 antitrypsin | Serum | 2488.32 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8599 | LEEYTKKLNTQ | Proapolipoprotein | Serum | 1365.71 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8600 | SRSGGGGGGGLGSGGSIRSSY | Cytokeratin | Serum | 1811.85 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8601 | SARLNSQRLVFNRPFLMFIVDNNILFLGKVNRP | Protein c inhibitor | Serum | 3888.15 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8602 | SARLNSQRLVFNRPFLMF | Protein c inhibitor | Serum | 2195.18 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8603 | SARLNSQRLVFNRPFLM | Protein c inhibitor | Serum | 2048.11 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8604 | VKVLDAVRGSPAIN | Prealbumin | Serum | 1437.83 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8605 | VVTNPKE | Prealbumin | Serum | 785.43 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8606 | DAHKSEVAHRF | Serum albumin | Serum | 1295.64 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8607 | DAHKSEVAHRFKD | Serum albumin | Serum | 1538.76 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8608 | PNHFRPAGLPEKY | SAA | Serum | 1524.78 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8609 | PITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE | SP40 | Serum | 4266.29 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8610 | FQKVKEKLKIDS | Apolipoprotein CI | Serum | 1461.86 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8611 | MGRVYDPRA | C1-inhibitor | Serum | 1063.52 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8612 | DEAGSEADHEGTHSTKRGHAKSRPV | Isoform 2 of fibrinogen (FGA) chain precursor | Serum | 2660.11 | MALDI-TOF | Breast cancer | Upregulated in cancer as compare to normal control with fold change of 1.5 | 26705257 |
| CancerPDF_ID8613 | SEMVVAGKLQ | Inter- trypsin inhibitor heavy chain H4 (ITIH4) precursor | Serum | 1061.09 | MALDI-TOF | Breast cancer | Upregulated in cancer as compare to normal control with fold change of 1.6 | 26705257 |
| CancerPDF_ID8614 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter- trypsin inhibitor heavy chain H4 (ITIH4) fragment | Serum | 3273.69 | MALDI-TOF | Breast cancer | Upregulated in cancer as compare to normal control with fold change of 1.7 | 26705257 |
| CancerPDF_ID8615 | IAQDLEMYGINYFEIK | EZR (Ezrin fragment) | Serum | 1945.33 | MALDI-TOF | Breast cancer | Upregulated in cancer as compare to normal control with fold change of 1.8 | 26705257 |
| CancerPDF_ID8616 | HNLGHGHKHERDQGHGHQ | Isoform HMW of kininogen-1 (KNG1) precursor | Serum | 2082.04 | MALDI-TOF | Breast cancer | Upregulated in cancer as compare to normal control with fold change of 1.9 | 26705257 |
| CancerPDF_ID8617 | NVHSAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter- trypsin inhibitor heavy chain H4 (ITIH4) fragment | Serum | 4280.55 | MALDI-TOF | Breast cancer | Upregulated in cancer as compare to normal control with fold change of 1.10 | 26705257 |
| CancerPDF_ID8618 | TPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS | Apolipoprotein C-I precursor | Serum | 6625.91 | MALDI-TOF | Breast cancer | Downregulated in cancer as compare to normal control with fold change of 1.5 | 26705257 |
| CancerPDF_ID8619 | FLGDRDFNQFSSGEKNIFLASFVHEYSR | Fetoprotein (AFP) precursor | Serum | 3315.21 | MALDI-TOF | Breast cancer | Downregulated in cancer as compare to normal control with fold change of 1.6 | 26705257 |
| CancerPDF_ID8620 | ARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ | Apolipoprotein A-I precursor | Serum | 6428.21 | MALDI-TOF | Breast cancer | Downregulated in cancer as compare to normal control with fold change of 1.7 | 26705257 |
| CancerPDF_ID8621 | VELGTQPATQ | Apolipoprotein A-II precursor | Serum | 1041.25 | MALDI-TOF | Breast cancer | Downregulated in cancer as compare to normal control with fold change of 1.8 | 26705257 |
| CancerPDF_ID8651 | KVAPAPAVVKKQEAKK | NA | Peripheral Blood mononuclear cells | NA | "HPLC (Biologic HR, BioRad, Hercules, CA), Mass spectrometry" | Breast cancer | NA | 22942358 |
| CancerPDF_ID8652 | RTYAGGTASATKVSASSGATSKS | NA | Peripheral Blood mononuclear cells | NA | "HPLC (Biologic HR, BioRad, Hercules, CA), Mass spectrometry" | Breast cancer | NA | 22942358 |
| CancerPDF_ID8653 | SESAAAPAFASSSSEVNPAPKFHW | NA | Peripheral Blood mononuclear cells | NA | "HPLC (Biologic HR, BioRad, Hercules, CA), Mass spectrometry" | Breast cancer | NA | 22942358 |
| CancerPDF_ID8654 | RRMRLTHCGLQEKHL | NA | Peripheral Blood mononuclear cells | NA | "HPLC (Biologic HR, BioRad, Hercules, CA), Mass spectrometry" | Breast cancer | NA | 22942358 |
| CancerPDF_ID8655 | GKFYLVIEELSQLFRSLVPIQL | NA | Peripheral Blood mononuclear cells | NA | "HPLC (Biologic HR, BioRad, Hercules, CA), Mass spectrometry" | Breast cancer | NA | 22942358 |
| CancerPDF_ID9933 | DEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21124649 |
| CancerPDF_ID9934 | NGFKSHALQLNNRQ | Complement C4-A | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21124649 |
| CancerPDF_ID9935 | RPPGFSPFR | Kininogen-1 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21124649 |
| CancerPDF_ID9936 | RPPGFSPFR | Kininogen-1 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21124649 |
| CancerPDF_ID9937 | RPPGFSPF | Kininogen-1 | Serum | NA | LC-MS | Breast cancer | NA | 21124649 |
| CancerPDF_ID9938 | SRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | NA | 21124649 |
| CancerPDF_ID9939 | SSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21124649 |
| CancerPDF_ID9940 | GVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21124649 |
| CancerPDF_ID9941 | PGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | NA | 21124649 |
| CancerPDF_ID9942 | RPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | NA | 21124649 |
| CancerPDF_ID9943 | FRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | NA | 21124649 |
| CancerPDF_ID9944 | NFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21124649 |
| CancerPDF_ID9945 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21124649 |
| CancerPDF_ID9946 | SRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21137033 |
| CancerPDF_ID9947 | SSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21137033 |
| CancerPDF_ID9948 | GVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21137033 |
| CancerPDF_ID9949 | PGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21137033 |
| CancerPDF_ID9950 | RPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21137033 |
| CancerPDF_ID9951 | FRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21137033 |
| CancerPDF_ID9952 | NFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21137033 |
| CancerPDF_ID9953 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21137033 |
| CancerPDF_ID12693 | VSFLSALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 1970.984 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.57 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.88, Upregulated in BC vs healthy with 0.925 fold change" | 27058005 |
| CancerPDF_ID12694 | HTFMGVVSLGSPSGEVSHPRKT | Alpha-2-HS-glycoprotein | Serum | 2326.204 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.58 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.25, Upregulated in BC vs healthy with 1.217 fold change" | 27058005 |
| CancerPDF_ID12695 | HRIHWE | Complement C3 | Serum | 877.0667 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.19 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.25, Upregulated in BC vs healthy with 1.065 fold change" | 27058005 |
| CancerPDF_ID12696 | IHWESASLL | Complement C3 | Serum | 1055.082 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.21 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.27, Upregulated in BC vs healthy with 1.126 fold change" | 27058005 |
| CancerPDF_ID12697 | SSKITHRIH | Complement C3 | Serum | 1078.125 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.03 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.19, Upregulated in BC vs healthy with 1.006 fold change" | 27058005 |
| CancerPDF_ID12698 | SVQLTEKRMD | Complement C3 | Serum | 1206.7 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.02 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.13, Upregulated in BC vs healthy with 1.024 fold change" | 27058005 |
| CancerPDF_ID12699 | RIHWESASLL | Complement C3 | Serum | 1211.694 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.17 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.22, Upregulated in BC vs healthy with 1.157 fold change" | 27058005 |
| CancerPDF_ID12700 | HRIHWESASLL | Complement C3 | Serum | 1348.755 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.59 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.13, Upregulated in BC vs healthy with 1.042 fold change" | 27058005 |
| CancerPDF_ID12701 | THRIHWESASLL | Complement C3 | Serum | 1449.804 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.52 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.25, Upregulated in BC vs healthy with 1.134 fold change" | 27058005 |
| CancerPDF_ID12702 | SKITHRIHWESAS | Complement C3 | Serum | 1551.893 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.18 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.17, Upregulated in BC vs healthy with 1.156 fold change" | 27058005 |
| CancerPDF_ID12703 | ITHRIHWESASLL | Complement C3 | Serum | 1562.888 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.30 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.22, Upregulated in BC vs healthy with 1.134 fold change" | 27058005 |
| CancerPDF_ID12704 | SVQLTEKRMDKVGK | Complement C3 | Serum | 1634.944 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.95 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.04, Upregulated in BC vs healthy with 1.049 fold change" | 27058005 |
| CancerPDF_ID12705 | KITHRIHWESASLL | Complement C3 | Serum | 1690.987 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 2.19 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.36, Upregulated in BC vs healthy with 1.341 fold change" | 27058005 |
| CancerPDF_ID12706 | SKITHRIHWESASLL | Complement C3 | Serum | 1778.018 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 2.10 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.37, Upregulated in BC vs healthy with 1.343 fold change" | 27058005 |
| CancerPDF_ID12707 | KITHRIHWESASLLR | Complement C3 | Serum | 1847.095 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.26 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.30, Upregulated in BC vs healthy with 1.623 fold change" | 27058005 |
| CancerPDF_ID12708 | SSKITHRIHWESASLL | Complement C3 | Serum | 1865.05 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 2.06 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.35, Upregulated in BC vs healthy with 1.344 fold change" | 27058005 |
| CancerPDF_ID12709 | SSKITHRIHWESASLLR | Complement C3 | Serum | 2021.146 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.02 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.19, Upregulated in BC vs healthy with 1.844 fold change" | 27058005 |
| CancerPDF_ID12710 | GFKSHALQLNNRQI | Complement C4 | Serum | 1625.946 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.68 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.78, Upregulated in BC vs healthy with 0.763 fold change" | 27058005 |
| CancerPDF_ID12711 | NGFKSHALQLNNRQ | Complement C4 | Serum | 1626.912 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.56 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.80, Upregulated in BC vs healthy with 0.754 fold change" | 27058005 |
| CancerPDF_ID12712 | NGFKSHALQLNNRQI | Complement C4 | Serum | 1739.971 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.76 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.83, Upregulated in BC vs healthy with 0.796 fold change" | 27058005 |
| CancerPDF_ID12713 | GFKSHALQLNNRQIR | Complement C4 | Serum | 1782.012 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.73 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.16, Upregulated in BC vs healthy with 1.092 fold change" | 27058005 |
| CancerPDF_ID12714 | NGFKSHALQLNNRQIR | Complement C4 | Serum | 1896.068 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.45 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.00, Upregulated in BC vs healthy with 0.968 fold change" | 27058005 |
| CancerPDF_ID12715 | HFFFPK | Clusterin | Serum | 822.485 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.31 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.10, Upregulated in BC vs healthy with 1.029 fold change" | 27058005 |
| CancerPDF_ID12716 | FPKSRIV | Clusterin | Serum | 846.533 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.50 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.21, Upregulated in BC vs healthy with 1.139 fold change" | 27058005 |
| CancerPDF_ID12717 | HFFFPKSRIV | Clusterin | Serum | 1277.758 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.39 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.17, Upregulated in BC vs healthy with 1.117 fold change" | 27058005 |
| CancerPDF_ID12718 | RPHFFFPKSRIV | Clusterin | Serum | 1530.912 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.26 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.16, Upregulated in BC vs healthy with 1.106 fold change" | 27058005 |
| CancerPDF_ID12719 | AVPPNNSNAAEDDLPTVELQGVVPR | Coagulation factor XIII A chain | Serum | 2602.306 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.47 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.04, Upregulated in BC vs healthy with 1.073 fold change" | 27058005 |
| CancerPDF_ID12720 | FLAEGGGVR | Fibrinogen alpha chain | Serum | 905.065 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.28 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.35, Upregulated in BC vs healthy with 1.203 fold change" | 27058005 |
| CancerPDF_ID12721 | SSSYSKQFTSSTS | Fibrinogen alpha chain | Serum | 1396.795 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.57 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.01, Upregulated in BC vs healthy with 0.963 fold change" | 27058005 |
| CancerPDF_ID12722 | NRGDSTFESKSYKM | Fibrinogen alpha chain | Serum | 1665.957 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.65 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.06, Upregulated in BC vs healthy with 1.083 fold change" | 27058005 |
| CancerPDF_ID12723 | SSSYSKQFTSSTSYNRGDSTFES | Fibrinogen alpha chain | Serum | 2553.201 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.60 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.85, Upregulated in BC vs healthy with 0.992 fold change" | 27058005 |
| CancerPDF_ID12724 | DEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Serum | 2659.323 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.73 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.88, Upregulated in BC vs healthy with 1.033 fold change" | 27058005 |
| CancerPDF_ID12725 | SSSYSKQFTSSTSYNRGDSTFESKS | Fibrinogen alpha chain | Serum | 2768.32 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.35 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.18, Upregulated in BC vs healthy with 1.074 fold change" | 27058005 |
| CancerPDF_ID12726 | SSYSKQFTSSTSYNRGDSTFESKSY | Fibrinogen alpha chain | Serum | 2931.376 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.79 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.00, Upregulated in BC vs healthy with 1.128 fold change" | 27058005 |
| CancerPDF_ID12727 | KMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Serum | 3005.608 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.73 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 2.39, Upregulated in BC vs healthy with 2.324 fold change" | 27058005 |
| CancerPDF_ID12728 | SSSYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha chain | Serum | 3206.443 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.44 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.05, Upregulated in BC vs healthy with 0.958 fold change" | 27058005 |
| CancerPDF_ID12729 | SSSYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha chain | Serum | 3277.592 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.43 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.11, Upregulated in BC vs healthy with 0.942 fold change" | 27058005 |
| CancerPDF_ID12730 | QAGAAGSRMNFRPGVLS | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 1717.941 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.91 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.93, Upregulated in BC vs healthy with 1.276 fold change" | 27058005 |
| CancerPDF_ID12731 | QAGAAGSRMNFRPGVLSS | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 1804.918 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.93 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.04, Upregulated in BC vs healthy with 1.080 fold change" | 27058005 |
| CancerPDF_ID12732 | YLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 1889.031 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.14 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.08, Upregulated in BC vs healthy with 1.244 fold change" | 27058005 |
| CancerPDF_ID12733 | YYLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 2051.125 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.80 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.02, Upregulated in BC vs healthy with 1.047 fold change" | 27058005 |
| CancerPDF_ID12734 | SRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 2271.203 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.99 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.93, Upregulated in BC vs healthy with 1.221 fold change" | 27058005 |
| CancerPDF_ID12735 | NVHSGSTFFKYYLQGAKIPKPEA | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 2582.393 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.38 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.62, Upregulated in BC vs healthy with 0.975 fold change" | 27058005 |
| CancerPDF_ID12736 | GVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 2627.365 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.51 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.86, Upregulated in BC vs healthy with 0.931 fold change" | 27058005 |
| CancerPDF_ID12737 | PGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 2724.46 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.22 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.72, Upregulated in BC vs healthy with 1.080 fold change" | 27058005 |
| CancerPDF_ID12738 | NVHSGSTFFKYYLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 3156.679 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.52 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.11, Upregulated in BC vs healthy with 1.158 fold change" | 27058005 |
| CancerPDF_ID12739 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 3272.752 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.42 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.89, Upregulated in BC vs healthy with 1.036 fold change" | 27058005 |
| CancerPDF_ID12740 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 3288.759 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.34 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.85, Upregulated in BC vs healthy with 1.126 fold change" | 27058005 |
| CancerPDF_ID12741 | QAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 3969.989 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.57 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.82, Upregulated in BC vs healthy with 1.170 fold change" | 27058005 |
| CancerPDF_ID12742 | RPPGFSPF | Kininogen-1 | Serum | 904.5017 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.29 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.40, Upregulated in BC vs healthy with 0.902 fold change" | 27058005 |
| CancerPDF_ID12743 | RPPGFSPFR | Kininogen-1 | Serum | 1060.627 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.79 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.82, Upregulated in BC vs healthy with 0.818 fold change" | 27058005 |
| CancerPDF_ID12744 | GHKHERDQGHGHQ | Kininogen-1 | Serum | 1522.838 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.81 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.88, Upregulated in BC vs healthy with 1.118 fold change" | 27058005 |
| CancerPDF_ID12745 | HGHKHERDQGHGHQ | Kininogen-1 | Serum | 1659.808 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.47 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.65, Upregulated in BC vs healthy with 1.231 fold change" | 27058005 |
| CancerPDF_ID12746 | GHGHKHERDQGHGHQ | Kininogen-1 | Serum | 1716.955 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.25 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.11, Upregulated in BC vs healthy with 1.154 fold change" | 27058005 |
| CancerPDF_ID12747 | NLGHGHKHERDQGHGHQ | Kininogen-1 | Serum | 1943.95 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.45 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.43, Upregulated in BC vs healthy with 1.386 fold change" | 27058005 |
| CancerPDF_ID12748 | HGLGHGHEQQHGLGHGHKF | Kininogen-1 | Serum | 2070.011 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.25 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.62, Upregulated in BC vs healthy with 1.201 fold change" | 27058005 |
| CancerPDF_ID12749 | HNLGHGHKHERDQGHGHQ | Kininogen-1 | Serum | 2081.006 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.43 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.71, Upregulated in BC vs healthy with 1.565 fold change" | 27058005 |
| CancerPDF_ID12750 | GHGLGHGHEQQHGLGHGHKF | Kininogen-1 | Serum | 2127.055 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.10 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.48, Upregulated in BC vs healthy with 1.279 fold change" | 27058005 |
| CancerPDF_ID12751 | KHNLGHGHKHERDQGHGHQ | Kininogen-1 | Serum | 2209.11 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.31 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.29, Upregulated in BC vs healthy with 1.499 fold change" | 27058005 |
| CancerPDF_ID12752 | KHNLGHGHKHERDQGHGHQR | Kininogen-1 | Serum | 2365.208 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.62 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.87, Upregulated in BC vs healthy with 1.340 fold change" | 27058005 |
| CancerPDF_ID12753 | GGPGGAGVARGGAGGGP | Neurogranin | Serum | 1251.732 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.16 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.07, Upregulated in BC vs healthy with 1.103 fold change" | 27058005 |
| CancerPDF_ID12754 | TPHPRPAPQSKPLASSGVPE | RIMS-binding protein-2 | Serum | 2053.134 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.77 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.99, Upregulated in BC vs healthy with 1.495 fold change" | 27058005 |
| CancerPDF_ID12891 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Upregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12892 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Upregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12893 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Upregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12894 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Upregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12895 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Downregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12896 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Downregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12897 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Upregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12898 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Upregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12899 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Upregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12900 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Downregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12901 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Downregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12902 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Upregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12903 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Upregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12904 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Downregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12905 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Downregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12906 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Downregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12907 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Downregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12908 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Downregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12909 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Upregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12910 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Upregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12911 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Upregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12912 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Upregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12913 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Upregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12914 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Upregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID14333 | NA | NA | Serum | 622.48 | IMAC-MB | Breast cancer | NA | 22521044 |
| CancerPDF_ID14334 | NA | NA | Serum | 622.97 | IMAC-MB | Breast cancer | NA | 22521044 |
| CancerPDF_ID14335 | NA | NA | Serum | 654.73 | IMAC-MB | Breast cancer | NA | 22521044 |
| CancerPDF_ID14336 | NA | NA | Serum | 655.23 | IMAC-MB | Breast cancer | NA | 22521044 |
| CancerPDF_ID14337 | NA | NA | Serum | 666.78 | IMAC-MB | Breast cancer | NA | 22521044 |
| CancerPDF_ID14338 | NA | NA | Serum | 667.12 | IMAC-MB | Breast cancer | NA | 22521044 |
| CancerPDF_ID14339 | NA | NA | Serum | 676.83 | IMAC-MB | Breast cancer | NA | 22521044 |
| CancerPDF_ID14340 | NA | NA | Serum | 698.4 | IMAC-MB | Breast cancer | NA | 22521044 |
| CancerPDF_ID14341 | NA | NA | Serum | 698.81 | IMAC-MB | Breast cancer | NA | 22521044 |
| CancerPDF_ID14342 | NA | NA | Serum | 720.8 | IMAC-MB | Breast cancer | NA | 22521044 |
| CancerPDF_ID14343 | NA | NA | Serum | 721.4 | IMAC-MB | Breast cancer | NA | 22521044 |
| CancerPDF_ID14344 | NA | NA | Serum | 858.11 | IMAC-MB | Breast cancer | NA | 22521044 |
| CancerPDF_ID14345 | NA | NA | Serum | 887.23 | IMAC-MB | Breast cancer | NA | 22521044 |
| CancerPDF_ID14346 | NA | NA | Serum | 893.99 | IMAC-MB | Breast cancer | NA | 22521044 |
| CancerPDF_ID14347 | NA | NA | Serum | 909.06 | IMAC-MB | Breast cancer | NA | 22521044 |
| CancerPDF_ID14348 | NA | NA | Serum | 909.75 | IMAC-MB | Breast cancer | NA | 22521044 |
| CancerPDF_ID14349 | NA | NA | Serum | 1618.46 | IMAC-MB | Breast cancer | NA | 22521044 |
| CancerPDF_ID14350 | NA | NA | Serum | 1866.64 | IMAC-MB | Breast cancer | NA | 22521044 |
| CancerPDF_ID14351 | NA | NA | Serum | 2770.34 | IMAC-MB | Breast cancer | NA | 22521044 |
| CancerPDF_ID14352 | NA | NA | Serum | 2771.86 | IMAC-MB | Breast cancer | NA | 22521044 |
| CancerPDF_ID14353 | NA | NA | Serum | 2933.97 | IMAC-MB | Breast cancer | NA | 22521044 |
| CancerPDF_ID14354 | NA | NA | Serum | 5963.91 | IMAC-MB | Breast cancer | NA | 22521044 |
| CancerPDF_ID14355 | NA | NA | Serum | 7772.04 | IMAC-MB | Breast cancer | NA | 22521044 |
| CancerPDF_ID14356 | NA | NA | Serum | 7777.16 | IMAC-MB | Breast cancer | NA | 22521044 |