Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID130 | SQVAQQARG | Apolipoprotein C-III | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID131 | ESQVAQQARG | Apolipoprotein C-III | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID132 | VQESQVAQQARG | Apolipoprotein C-III | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID133 | YMKHATKTAKD | Apolipoprotein C-III | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID134 | SSVQESQVAQQARG | Apolipoprotein C-III | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID135 | YMKHATKTAKDAL | Apolipoprotein C-III | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID287 | ATKTAKDALSSVQESQVAQQ | Apolipoprotein C-III | Plasma | 697.3576667 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID288 | TAKDALSSVQESQVAQQAR | Apolipoprotein C-III | Plasma | 1009.0155 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID289 | TAKDALSSVQESQVAQQA | Apolipoprotein C-III | Plasma | 930.965 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID290 | TAKDALSSVQESQVAQQ | Apolipoprotein C-III | Plasma | "895.45, 597.3" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID291 | TAKDALSSVQESQVAQ | Apolipoprotein C-III | Plasma | 831.4175 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID292 | TAKDALSSVQESQ | Apolipoprotein C-III | Plasma | 682.335 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID293 | TAKDALSSVQES | Apolipoprotein C-III | Plasma | 618.306 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID294 | KDALSSVQESQVAQQAR | Apolipoprotein C-III | Plasma | 615.649 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID295 | KDALSSVQESQVAQQA | Apolipoprotein C-III | Plasma | 844.9225 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID296 | KDALSSVQESQVAQQ | Apolipoprotein C-III | Plasma | 809.404 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID297 | KDALSSVQESQVAQ | Apolipoprotein C-III | Plasma | 745.375 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID298 | DALSSVQESQVAQQAR | Apolipoprotein C-III | Plasma | "858.93, 572.95" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID299 | DALSSVQESQVAQQA | Apolipoprotein C-III | Plasma | 780.8755 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID300 | DALSSVQESQVAQQ | Apolipoprotein C-III | Plasma | 745.3565 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID301 | DALSSVQESQVAQ | Apolipoprotein C-III | Plasma | 681.3275 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID302 | LSSVQESQVAQQAR | Apolipoprotein C-III | Plasma | 765.894 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID303 | SSVQESQVAQQARGWVTDGF | Apolipoprotein C-III | Plasma | 1090.5185 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID304 | DKFSEFWDLDPEVRPT | Apolipoprotein C-III | Plasma | "990.97, 660.98" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID305 | SEFWDLDPEVRPTSAVAA | Apolipoprotein C-III | Plasma | 995.478 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID306 | WDLDPEVRPTSAVAA | Apolipoprotein C-III | Plasma | 813.9065 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID307 | DLDPEVRPT | Apolipoprotein C-III | Plasma | 521.261 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID308 | SEAEDASLLSFMQGYMK | Apolipoprotein C-III | Plasma | 953.9285 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID309 | SEAEDASLLSFMQGY | Apolipoprotein C-III | Plasma | 824.3605 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID310 | SEAEDASLLSFM | Apolipoprotein C-III | Plasma | 650.289 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID311 | GWVTDGFSSLK | Apolipoprotein C-III | Plasma | 598.7975 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID312 | WVTDGFSSLK | Apolipoprotein C-III | Plasma | 570.287 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID1748 | SEAEDASLLSFMQGYMKHATK | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 2343.08752 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1749 | TAKDALSSVQESQVAQQAR | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 2016.0236 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1750 | SEAEDASLLSFMQGYMKHAT | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 2214.99255 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1751 | SEAEDASLLSFMQGYMKHATKTAK | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 2643.26727 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1752 | DALSSVQESQVAQQA | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 1559.74273 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1753 | TAKDALSSVQESQVAQQA | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 1859.92248 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1754 | SEAEDASLLSFMQGYMKHAT | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 2230.98747 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1755 | SEAEDASLLSFMQGYMKHATKTA | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 2515.17231 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1756 | DALSSVQESQVAQQAR | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 1715.84384 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1757 | SEAEDASLLSFMQGYM | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 1777.75389 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1758 | SEAEDASLLSFMQGYMK | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 1905.84885 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1759 | HATKTAKDALSSVQESQVAQQA | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 2297.16115 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1760 | DALSSVQESQVAQQ | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 1488.70562 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1761 | HATKTAKDALSSVQESQVAQQAR | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 2453.26226 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1762 | SEAEDASLLSFMQGYMKHATKTA | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 2531.16722 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1763 | SEAEDASLLSFMQGYMK | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 1921.84377 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1764 | SEAEDASLLSFMQGYM | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 1793.7488 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1765 | EAEDASLLSFMQGYM | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 1690.72186 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1766 | AKDALSSVQESQVAQQA | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 1758.87481 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2977 | LSSVQESQVAQQAR | Apolipoprotein C-III | Plasma | 1529.7798 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2978 | DALSSVQESQVAQQA | Apolipoprotein C-III | Plasma | 1559.7427 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2979 | DALSSVQESQVAQQAR | Apolipoprotein C-III | Plasma | 1715.8438 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2980 | TAKDALSSVQESQVAQQA | Apolipoprotein C-III | Plasma | 1859.9225 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2981 | SEAEDASLLSFMQGYMK | Apolipoprotein C-III | Plasma | 1905.8488 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2982 | TAKDALSSVQESQVAQQAR | Apolipoprotein C-III | Plasma | 2016.0236 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2983 | GWVTDGFSSLKDYWSTVK | Apolipoprotein C-III | Plasma | 2075 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2984 | SEAEDASLLSFMQGYMKHAT | Apolipoprotein C-III | Plasma | 2214.9926 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2985 | HATKTAKDALSSVQESQVAQQA | Apolipoprotein C-III | Plasma | 2297.1612 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2986 | SEAEDASLLSFMQGYMKHATK | Apolipoprotein C-III | Plasma | 2343.0875 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2987 | HATKTAKDALSSVQESQVAQQAR | Apolipoprotein C-III | Plasma | 2453.2623 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2988 | SEAEDASLLSFMQGYMKHATKTA | Apolipoprotein C-III | Plasma | 2515.1723 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2989 | DALSSVQESQVAQQARGWVTDGFSSL | Apolipoprotein C-III | Plasma | 2765.3257 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2990 | DALSSVQESQVAQQARGWVTDGFSSLK | Apolipoprotein C-III | Plasma | 2893.4206 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2991 | TAKDALSSVQESQVAQQARGWVTDGFSSL | Apolipoprotein C-III | Plasma | 3065.5054 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3268 | NA | Apolipoprotein C-III | Serum | 9443 | MALDI-TOF | Stomach adenocarcinoma | Differentially expressed in cancer patients as cpmpare to normal | 21267442 |
| CancerPDF_ID3738 | SEAEDASLLSFMQGYMKHATK | Apolipoprotein C-III | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID4357 | ARGWVTDGF | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4358 | ARGWVTDGFSSL | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4604 | DKFSEFWDLD | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4711 | DYWSTVKDKFS | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5341 | GWVTDGFSSLKD | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5342 | GWVTDGFSSLKDY | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5343 | GWVTDGFSSLKDYWSTV | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6488 | QARGWVTDGFSSLKDY | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6517 | QESQVAQQARGWVTDGF | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6571 | QQARGWVTDGF | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6593 | QVAQQARGWVTDGFSSL | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6594 | QVAQQARGWVTDGFSSLKD | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6595 | QVAQQARGWVTDGFSSLKDY | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6673 | RGWVTDGF | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7059 | SQVAQQARGWVTDGF | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7060 | SQVAQQARGWVTDGFSSL | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7103 | SSLKDYWSTV | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7104 | SSLKDYWSTVKDK | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7105 | SSLKDYWSTVKDKFS | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7106 | SSLKDYWSTVKDKFSE | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7107 | SSLKDYWSTVKDKFSEF | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7136 | SSVQESQVAQQARGWVTDG | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7137 | SSVQESQVAQQARGWVTDGF | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7138 | SSVQESQVAQQARGWVTDGFSSLKD | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7139 | SSVQESQVAQQARGWVTDGFSSLKDY | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7140 | SSVQESQVAQQARGWVTDGFSSLKDYWSTV | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7712 | VAQQARGWVTDGF | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8020 | VTDGFSSLKDYW | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8021 | VTDGFSSLKDYWSTV | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8199 | WVTDGFSSLKDY | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID9575 | KDALSSVQESQVAQQA | Apolipoprotein C-III | Serum | 844.92 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9576 | TAKDALSSVQESQVAQQA | Apolipoprotein C-III | Serum | 620.98 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9577 | HATKTAKDALSSVQESQVAQQA | Apolipoprotein C-III | Serum | 766.73 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID10150 | SSVQESQVAQQARG | Apolipoprotein C-III | Urine | 1474.7313 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10315 | KDYWSTVKDKFSEF | Apolipoprotein C-III | Urine | 1779.862 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10443 | SSLKDYWSTVKDKFSEF | Apolipoprotein C-III | Urine | 2066.9939 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10508 | FSSLKDYWSTVKDKFSEF | Apolipoprotein C-III | Urine | 2214.0781 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10669 | YMKHATKTAKDALSSVQESQVAQQARG | Apolipoprotein C-III | Urine | 2933.4811 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11974 | PEVRPTSAVA | Apolipoprotein C-III | Serum | 1025.5506 | LC-MS | Melanoma | "Present in 8 cancer samples out of 8 cancer samples. ,Present in 4 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID11975 | PEVRPTSAVAA | Apolipoprotein C-III | Serum | 1096.5877 | LC-MS | Melanoma | "Present in 8 cancer samples out of 8 cancer samples. ,Present in 4 healthy samples out of 4 healthy samples." | 26992070 |