Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID5291 | GSKGPGEDFRMATL | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5373 | HGVGDWGSTY | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5374 | HGVGDWGSTYSV | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5542 | IVFLPQTDKCMTEQ | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5943 | LLYSQGSKGPGEDFRMA | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5945 | LLYSQGSKGPGEDFRMAT | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5947 | LLYSQGSKGPGEDFRMATL | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6021 | LQPAGSLGSYS | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6151 | LYSQGSKGPGEDFRMA | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6153 | LYSQGSKGPGEDFRMAT | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6155 | LYSQGSKGPGEDFRMATL | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6412 | PNFQQDKFLGRW | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6434 | PQTDKCMTEQ | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6596 | QVSVQPNFQQDKFLGRW | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6597 | QVSVQPNFQQDKFLGRWF | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6598 | QVSVQPNFQQDKFLGRWFSA | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6600 | QVSVQPNFQQDKFLGRWFSAG | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6602 | QVSVQPNFQQDKFLGRWFSAGL | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7168 | SVQPNFQQDKFLGRW | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7169 | SVQPNFQQDKFLGRWF | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7171 | SVQPNFQQDKFLGRWFSA | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7175 | SVSVVETDYDQY | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7177 | SVSVVETDYDQYA | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7179 | SVSVVETDYDQYALLYSQGSKGPGEDFRMAT | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7185 | SVVETDYDQY | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7187 | SVVETDYDQYA | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7189 | SVVETDYDQYAL | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7191 | SVVETDYDQYALLY | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7193 | SVVETDYDQYALLYSQGSKGPGEDFRMA | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7195 | SVVETDYDQYALLYSQGSKGPGEDFRMAT | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7197 | SVVETDYDQYALLYSQGSKGPGEDFRMATL | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7334 | TAFCKAQGF | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7336 | TAFCKAQGFTEDT | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7338 | TAFCKAQGFTEDTI | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7340 | TAFCKAQGFTEDTIV | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7342 | TAFCKAQGFTEDTIVFLPQTDKCMTEQ | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7362 | TDYDQYALLYSQGSKGPGEDFRM | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7364 | TDYDQYALLYSQGSKGPGEDFRMA | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7366 | TDYDQYALLYSQGSKGPGEDFRMATL | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7449 | TIVFLPQTDKCMTEQ | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7493 | TLGQPPAAEIHGVGDWGSTYS | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7791 | VETDYDQYALLYSQGSKGPGEDFRM | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7793 | VETDYDQYALLYSQGSKGPGEDFRMA | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7795 | VETDYDQYALLYSQGSKGPGEDFRMAT | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7797 | VETDYDQYALLYSQGSKGPGEDFRMATL | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7834 | VFLPQTDKCMTEQ | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8009 | VSVQPNFQQDKFLGRW | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8070 | VVETDYDQYA | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8072 | VVETDYDQYAL | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8073 | VVETDYDQYALL | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8075 | VVETDYDQYALLYSQGSKGPGEDFRMA | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8077 | VVETDYDQYALLYSQGSKGPGEDFRMATL | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8366 | YSQGSKGPGED | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8367 | YSQGSKGPGEDFRM | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8370 | YSQGSKGPGEDFRMAT | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8372 | YSQGSKGPGEDFRMATL | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8379 | YSVSVVETDYDQYALL | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |