Primary information |
---|
ID | antitb_1628 |
Peptide Name | LL-37 |
Sequence | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
N-terminal Modification | Free |
C-terminal Modification | Free |
Chemical Modification | None |
Linear/ Cyclic | Linear |
Length | 37 |
Chirality | L |
Nature | Cationic |
Source | Synthetic |
Origin | NA |
Species | Mycobacterium smegmatis |
Strain | Mycobacteria smegmatis mc2 155 |
Inhibition Concentartion | MIC = 2400 μg/ml |
In vitro/In vivo | in vitro |
Cell Line | J774 macrophage cell lines |
Inhibition Concentartion | NA |
Cytotoxicity | IC50= 11226 μg/ml |
In vivo Model | NA |
Lethal Dose | NA |
Immune Response | Stimulation of TNF-α production |
Mechanism of Action | inhibit bacterial Atpase activity |
Target | NA |
Combination Therapy | NA |
Other Activities | NA |
Pubmed ID | 26218806 |
Year of Publication | 2015 |
3-D Structure | View in Jmol or Download Structure |