Browse result page of AntiTbPdb
The total number entries retrieved from this search are 550
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1929 | Peptide-3 | GF(A6c)G(A6c)Orn(A6c)G(A6c)F(A6c)G(A6c)GOrn(A6c)Orn-Orn- Orn- Orn | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, orn = ornithine | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC = 11.37 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1930 | Peptide-4 | GF(A6c)G(A6c)Dab(A6c)G(A6c)F(A6c)G(A6c)GDab(A6c)Dab-Dab-Dab-Dab | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, Dab = 2,4-diaminobutyric acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC =25.65 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1931 | Peptide-5 | GF(A6c)G(A6c)Dpr(A6c)G(A6c)F(A6c)G(A6c)GDpr(A6c) Dpr-Dpr-Dpr- Dpr | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, Dpr = 2,4-diaminopropanoic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC = 49.26 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1932 | Peptide-6 | GF(A5c)G(A5c)K(A5c)G(A5c)F(A5c)G(A5c)GK(A5c)KKKK | Acetylation | Amidation | A5c = 1-aminocyclopentane carboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC = 22.85 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1933 | Peptide-7 | GF(A5c)G(A5c)R(A5c)G(A5c)F(A5c)G(A5c)GR(A5c)RRRR | Acetylation | Amidation | A5c = 1-aminocyclopentane carboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC >43 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1934 | Peptide-8 | GF(A6c)G(Tic)K(A6c)G(Tic)F(A6c)G(Tic)GK(Tic)KKKK | Acetylation | Amidation | Tic = Tetrahydroisoquinolinecarboxylic acid, A6c 1-aminocyclohexane carboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC = 20.6μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1935 | Peptide-9 | GF(A6c)G(Oic)K(A6c)G(Oic)F(A6c)G(Oic)GK(Oic)KKKK | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, Oic = Octahydroindolecarboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC = 20.92 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1936 | Peptide-10 | GF(A5c)G(A6c)K(A5c)G(A6c)F(A5c)G(A6c)GK(A5c)KKKK | Acetylation | Amidation | A5c = 1-aminocyclopentane carboxylic acid, A6c 1-aminocyclohexane carboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC = 11.21 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1937 | Peptide-11 | KKKKGF(A6c)G(A6c)K(A6c)G(A6c)F(A6c)G(A6c)GK(A6c) | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC = 5.47 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1938 | Peptide-1 | GF(A6c)G(A6c)KK(A6c)G(A6c)F(A6c)G(A6c)GKK(A6c)KKKK | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, | Linear | 22 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR | MIC =4.92 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1939 | Peptide-2 | GF(A6c)G(A6c)R(A6c)G(A6c)F(A6c)G(A6c)GR(A6c)RRRR | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, | Linear | 19 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR | MIC = 10.19 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1940 | Peptide-3 | GF(A6c)G(A6c)Orn(A6c)G(A6c)F(A6c)G(A6c)GOrn(A6c)Orn-Orn- Orn- Orn | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, orn = ornithine | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR | MIC = 11.37 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1941 | Peptide-4 | GF(A6c)G(A6c)Dab(A6c)G(A6c)F(A6c)G(A6c)GDab(A6c)Dab-Dab-Dab-Dab | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, Dab = 2,4-diaminobutyric acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR | MIC =25.65 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1942 | Peptide-5 | GF(A6c)G(A6c)Dpr(A6c)G(A6c)F(A6c)G(A6c)GDpr(A6c) Dpr-Dpr-Dpr- Dpr | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, Dpr = 2,4-diaminopropanoic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR | MIC = 49.26 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1943 | Peptide-6 | GF(A5c)G(A5c)K(A5c)G(A5c)F(A5c)G(A5c)GK(A5c)KKKK | Acetylation | Amidation | A5c = 1-aminocyclopentane carboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR | MIC = 11.45 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1944 | Peptide-7 | GF(A5c)G(A5c)R(A5c)G(A5c)F(A5c)G(A5c)GR(A5c)RRRR | Acetylation | Amidation | A5c = 1-aminocyclopentane carboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR | MIC >43 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1945 | Peptide-8 | GF(A6c)G(Tic)K(A6c)G(Tic)F(A6c)G(Tic)GK(Tic)KKKK | Acetylation | Amidation | Tic = Tetrahydroisoquinolinecarboxylic acid, A6c 1-aminocyclohexane carboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR | MIC = 20.6μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1946 | Peptide-9 | GF(A6c)G(Oic)K(A6c)G(Oic)F(A6c)G(Oic)GK(Oic)KKKK | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, Oic = Octahydroindolecarboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR | MIC = 20.92 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1947 | Peptide-10 | GF(A5c)G(A6c)K(A5c)G(A6c)F(A5c)G(A6c)GK(A5c)KKKK | Acetylation | Amidation | A5c = 1-aminocyclopentane carboxylic acid, A6c 1-aminocyclohexane carboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR | MIC = 11.21 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1948 | Peptide-11 | KKKKGF(A6c)G(A6c)K(A6c)G(A6c)F(A6c)G(A6c)GK(A6c) | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR | MIC = 10.94 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1953 | Wollamide- B | WAlVNx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 80 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1954 | Wollamide- B | ALlVNx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 80 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1955 | Wollamide- B | WLlVAx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 20 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1956 | Wollamide- B | WLlANx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 80 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1957 | Wollamide- B | WLaVNx | Free | Free | Third residue is D-alanine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 80 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1958 | Wollamide- B | WLlINx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 1.1 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 50 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1959 | Wollamide- B | WLlMNx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 80 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1960 | Wollamide- B | WLlVxx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC =2.5 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 50 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1961 | Wollamide- B | WLlISx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC =15 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1962 | Wollamide- B | WLlIXx | Free | Free | Third residue is D-leucine, fifth residue is tertiary butyl serine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 40 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1963 | Wollamide- B | WLlIIx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 3.1 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1964 | Wollamide- B | WLlINr | Free | Free | Third residue is D-leucine and r= D- arginine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 0.6 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1965 | Wollamide- B | xLlVNx | Free | Free | First residue is D- phenyalanine, Third is D-leucine and sixth is D-ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 40 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1972 | Granulysin | RLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL | Free | Free | None | Linear | 123 | Mix | Cationic | Natural | Homo sapiens | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 90% Killing | In vivo | CD8+ T | NA | NA | NA | NA | NA | Altering Membrane Permeability | cell wall (lipid bilayer) | Perforin (2000 U/ml)+granulysin (25 µM) | Cryptococcus neoformans, Candida albicans, Leishmania major, S. typhimurium, L. monocytogenes, E. coli, and Staphylococcus aureus | 1988 | 9756476 |
| antitb_1973 | Granulysin | RLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL | Free | Free | None | Linear | 123 | Mix | Cationic | Natural | Homo sapiens | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 10-15% Killing | In vivo | CD8+ T | NA | NA | NA | NA | NA | Altering Membrane Permeability | cell wall (lipid bilayer) | NA | Cryptococcus neoformans, Candida albicans, Leishmania major, S. typhimurium, L. monocytogenes, E. coli, and Staphylococcus aureus | 1988 | 9756476 |
| antitb_1980 | Granulysin(1-35) | GRDYRTSLTIVQKLKKMVDKPTQRSVSNAATRVSR | Free | Free | butanedione (BAD) or citraconic anhydride(CAH) | Linear | 35 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 25-40% Killing -25µM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA |  Escherichia coli | 2000 | 11120840 |
| antitb_1981 | Granulysin(1-35) | GRDYRTSLTIVQKLKKMVDKPTQRSVSNAATRVSR | Free | Free | butanedione (BAD) or citraconic anhydride(CAH) | Linear | 35 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 45-60% Killing -100 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA |  Escherichia coli | 2000 | 11120840 |
| antitb_1982 | Granulysin(36-70) | TGRSRWRDVSRNFMRRYQSRVIQGLVAGETAQQIS | Free | Free | butanedione (BAD) or citraconic anhydride(CAH) | Linear | 35 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 25-40% Killing -25µM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA |  Escherichia coli | 2000 | 11120840 |
| antitb_1983 | Granulysin(36-70) | TGRSRWRDVSRNFMRRYQSRVIQGLVAGETAQQIS | Free | Free | butanedione (BAD) or citraconic anhydride(CAH) | Linear | 35 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 45-60% Killing -100 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA |  Escherichia coli | 2000 | 11120840 |
| antitb_1984 | Granulysin(31-50) | TRVSRTGRSRWRDVSRNFMR | Free | Free | butanedione (BAD) or citraconic anhydride(CAH) | Linear | 20 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 25-40% Killing -25µM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA |  Escherichia coli | 2000 | 11120840 |
| antitb_1985 | Granulysin(31-50) | TRVSRTGRSRWRDVSRNFMR | Free | Free | butanedione (BAD) or citraconic anhydride(CAH) | Linear | 20 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 45-60% Killing -100 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA |  Escherichia coli | 2000 | 11120840 |
| antitb_1988 | Teixobactin | FISQIISTAI | Free | Free | adenylation, C, condensation; MT, methylation (of phenylalanine); T, thiolation (carrier); and TE,thioesterase (Ile-Thr ring closure). NmPhe,N-methylated phenylalanin | Cyclic | 10 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC= 0.125µg/ml | In vitro | NA | NA | NA | NA | NA | NA | Binding of teixobactin to WTA precursor contributes to efficient lysis and killing, due to digestion of the cell wall by liberated autolysins | Cell wall | NA | S. aureus (MSSA), S. aureus 110% serum, S. aureus (MRSA), Enterococcus faecalis (VRE), Enterococcus faecium (VRE), Streptococcus pneumoniae (penicillinR), Streptococcus pyogenes, Streptococcus agalactiae, Viridans group streptococci, B. anthracis, Clostridium difficile, Propionibacterium acnes, Haemophilus influenzae, Moraxella catarrhalis, Escherichia coli, Escherichia coli (asmB1), Pseudomonas aeruginosa, Klebsiella pneumoniae | 2015 | 25561178 |
| antitb_1990 | VpAmp1.0 | LPFFLLSLIPSAISAIKKI | Free | Amidation | None | Linear | 19 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC= 17.4 ± 6.4 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall | NA | Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus agalactiae | 2015 | 26352292 |
| antitb_1991 | VpAmp1.0 | LPFFLLSLIPSAISAIKKI | Free | Amidation | None | Linear | 19 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC= 4.8 ± 1.5µM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall | NA | Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus agalactiae | 2015 | 26352292 |
| antitb_1992 | VpAmp1.1 | FFLLSLIPSAISAIKKI | Free | Amidation | None | Linear | 17 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC= 5.4 ± 1.7 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall | NA | Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus agalactiae | 2015 | 26352292 |
| antitb_1993 | VpAmp1.1 | FFLLSLIPSAISAIKKI | Free | Amidation | None | Linear | 17 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC= 8.6 ± 3.3 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall | NA | Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus agalactiae | 2015 | 26352292 |
| antitb_1994 | VpAmp2.0 | FWGFLGKLAMKAVPSLIGGNKSSSK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC= 21.4 ± 7.5 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall | NA | Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus agalactiae | 2015 | 26352292 |
| antitb_1995 | VpAmp2.0 | FWGFLGKLAMKAVPSLIGGNKSSSK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC= 30.5 ± 9.5 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall | NA | Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus agalactiae | 2015 | 26352292 |
| antitb_1996 | VpAmp2.1 | FWGFLGKLAMKAVPSLIGGNKK | Free | Free | None | Linear | 22 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC= 13.6 ± 5.3 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall | NA | Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus agalactiae | 2015 | 26352292 |
| antitb_1997 | VpAmp2.1 | FWGFLGKLAMKAVPSLIGGNKK | Free | Free | None | Linear | 22 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC= 8.5 ± 2.6 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall | NA | Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus agalactiae | 2015 | 26352292 |