Browse result page of AntiTbPdb
The total number entries retrieved from this search are 4
ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
antitb_1687 | S-520 | not available | NA | NA | None | NA | 0 | NA | NA | Natural | Streptomyces diastaticus | Mycobacterium phlei | Mycobacterium phlei | MIC = 5 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against Bacillus subtilis, Bacillus anthracis, Staphylococcus aureus, Staphylococcus aureus,Streptococcus pyogenes,Diplococcus pneumoniae, Sarcinalutea Corynebacterium diphtheriae | 1970 | 5459623 |
antitb_1776 | Sesquin | KTCENLADTY | Free | Free | None | Linear | 10 | L | Cationic | Natural | Isolated from ground beans (Vigna sesquipedalis cv. ‘Ground Bean’) | Mycobacterium phlei | Mycobacterium phlei | IC50 = 87 ± 5 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial, Antifungal | 2005 | 15949629 |
antitb_1777 | Mitogenic defensin | MEKKSFAGLCFLFLVLFVAQECVLQTEAKTCENLADTFRGPCFATGNCDDHCKNKEHLLRGRCRDDFRCWCTRNC | Free | Free | Disulfide linkage | Cyclic | 75 | L | Cationic | Natural | From the seeds of white cloud beans (Phaseolus vulgaris cv. ‘white cloud bean’) | Mycobacterium phlei | Mycobacterium phlei | IC50 = 86 ± 6 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial, Antifungal | 2006 | 16687191 |
antitb_1882 | Propeptin-2 | GYPWWDYRDLFGGHTFI | Involved in Cyclic bond formation between amino acid 1 and 9 | Free | None | Cyclic | 17 | D | NA | Natural | Isolated from Microbispora species SNA-115 | Mycobacterium phlei | Mycobacterium phlei IFO 3158 | 40 μg/disc | In vitro | NA | Treatment of infected Mycobacterium phlei with 40 μg/disc of Propeptin-2 decreased approximately 90% of the bacterial load in zone inhibition assay | NA | NA | NA | NA | NA | NA | None | Antibacterial against silkworm | 2007 | 17827663 |