Browse result page of AntiTbPdb
The total number entries retrieved from this search are 1
ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
antitb_1810 | Mcdef | GFGCPNDYSCSNHCRDSIGCRGGYCKYQLICTCYGCKKRRSIQE | Free | Free | 4 disulfide linkages between 4-25, 10-31, 14-33, 20-36 | Cyclic | 44 | L | Cationic | Protein Derived | detected in hemocytes of Manila clams (Ruditapes philippinarum). | Mycobacterium fortuitum | Mycobacterium fortuitum | MIC >20 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Staphylococcus aureus KCTC 1916, Streptococcus iniae KCTC 3651, orynebacterium diphtheriae, Bacillus subtilis, ibrio logei KCCM 12281, Vibrio salmonicida KCCM 41663) | 2011 | 21945146 |