Browse result page of AntiTbPdb
The total number entries retrieved from this search are 50
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1219 | Cathelicidin HHC-10 | KRWWKWIRW | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium tuberculosis complex bacteria, Mycobacterium bovis bacille calmette guerin (BCG) (Mycobacterium bovis BCG Pasteur 1173P2) | 69 % decrease in CFU at 50 μg/ ml | Both | None | NA | NA | 8–9 weeks old C57BL/6 mice | CFUs in mouse lungs were reduced 77.8% at 1.25 mg | Significant reduction of IFN-γ transcription | Cell envelope disruption | Cell envelope | None | Antibacterial (such as Pseudomonas aeruginosa, Escherichia coli, Klebsiella pneumonia, and S. aureus etc | 2013 | 23231581 |
| antitb_1220 | Cathelicidin HHC-10 | KRWWKWIRW | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium tuberculosis complex bacteria, Mycobacterium bovis bacille calmette guerin (BCG) (Mycobacterium bovis BCG Pasteur 1173P2) | 88 % decrease in CFU at 100 μg/ ml | Both | None | NA | NA | 8–9 weeks old C57BL/6 mice | CFUs in mouse lungs were reduced 95.8% at 2.5 mg k | Significant reduction of IFN-γ transcription | Cell envelope disruption | Cell envelope | None | Antibacterial (such as Pseudomonas aeruginosa, Escherichia coli, Klebsiella pneumonia, and S. aureus etc | 2013 | 23231581 |
| antitb_1226 | Human neutrophil peptide 1 (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulfide bridge: 2-30, 4-19, 9-32 | Cyclic | 30 | L | NA | Protein Derived | Human neutrophil | Mycobacterium bovis | Mycobacterium bovis BCG | 99.6 % inhibition at 10 μg/ml | In vitro | THP-1 cells | Significant reduction in CFU | NA | None | NA | NA | NA | NA | None | None | 2013 | 23827033 |
| antitb_1227 | Human neutrophil peptide 1 (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulfide bridge: 2-30, 4-19, 9-33 | Cyclic | 30 | L | NA | Protein Derived | Human neutrophil | Mycobacterium bovis | Mycobacterium bovis BCG | 100 % inhibition at 10 μg/ml | In vitro | THP-1 cells | Significant reduction in CFU | NA | None | NA | NA | NA | NA | None | None | 2013 | 23827033 |
| antitb_1231 | (LLKK)2 | LLKKLLKK | Free | Free | None | Linear | 8 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG lux | MIC = 500 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1236 | C(LLKK)2 | CLLKKLLKK | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG lux | MIC = 250 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1244 | (LLKK)2M | LLKKLLKKM | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG lux | MIC = 500 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1251 | M(LLKK)2M | MLLKKLLKKM | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG lux | MIC = 15.6 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1252 | M(LLKK)2M | MLLKKLLKKM | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG lux | MIC = 3.91 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | Rifampicin, shows synergy | Antibacterial | 2014 | 24314557 |
| antitb_1294 | Trichoderins A | (MDA)-P-(AHMOD)-(Aib)-(Aib)-I-V-(Aib)-(Aib)-(AMAE) | Addition of MDA = 2-methyl decanoic acid. | Addition of AMAE = 2-[(20-aminopropyl) methylamino] ethanol. | AHMOD = 2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid, Aib = α-amino- isobutyric acid | Linear | 8 | L | NA | Natural | Isolated from a culture of marine sponge derived fungus of Trichoderma sp. | Mycobacterium bovis | Mycobacterium bovis BCG | MIC =0.02 μg/mL | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | None | 2010 | 20483615 |
| antitb_1297 | Trichoderins A1 | (MDA)-P-(AMOD)-(Aib)-(Aib)-I-V-(Aib)-(Aib)-(AMAE) | Addition of MDA = 2-methyl decanoic acid. | Addition of AMAE = 2-[(20-aminopropyl) methylamino] ethanol. | AMOD = 2-amino-4-methy1-8-oxodec-6-enoic acid, Aib = a-amino- isobutyric acid, | Linear | 8 | L | NA | Natural | Isolated from a culture of marine sponge derived fungus of Trichoderma sp. | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 0.16 μg/mL | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | None | 2010 | 20483615 |
| antitb_1300 | Trichoderins B | (MDA)-P-(AHMOD)-(Aib)-(Aib)-V-V-(Aib)-(Aib)-(AMAE) | Addition of MDA = 2-methyl decanoic acid. | Addition of AMAE = 2-[(20-aminopropyl) methylamino] ethanol. | AHMOD = 2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid, Aib = α-amino- isobutyric acid | Linear | 8 | L | NA | Natural | Isolated from a culture of marine sponge derived fungus of Trichoderma sp. | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 0.02 μg/mL | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | None | 2011 | 20483615 |
| antitb_1324 | Peptoid 1 | H-(NLys-Nspe-Nspe)4-NH2 | Free | Amidation | Nlys = N-(4-aminobutyl)glycine, Nspe = (S)-N-(1-phenylethyl)glycine | Linear | 12 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 12.5-25 μM | In vitro | Raw 264.7 and J774 mouse macrophage | NA | LD50 = 14.1μM | NA | NA | NA | NA | NA | NA | NA | 2011 | 21464254 |
| antitb_1325 | 1-C134mer | H-Ntridec-NLys-Nspe-Nspe-NLys-NH2 | Free | Amidation | Nlys = N-(4-aminobutyl)glycine, Nspe = (S)-N-(1-phenylethyl)glycine, Ntridec = N-(tridecyl)glycine | Linear | 5 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 6.3 μM | In vitro | Raw 264.7 and J774 mouse macrophage | NA | LD50 = >100 μM | NA | NA | NA | NA | NA | NA | NA | 2011 | 21464254 |
| antitb_1326 | 14mer | H-NLys-Nspe-Nspe-NLys-NH2 | Free | Amidation | Nlys = N-(4-aminobutyl)glycine, Nspe = (S)-N-(1-phenylethyl)glycine | Linear | 4 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = >100 μM | In vitro | Raw 264.7 and J774 mouse macrophage | NA | Non toxic | NA | NA | NA | NA | NA | NA | NA | 2011 | 21464254 |
| antitb_1327 | 1-Pro9 | H-(NLys-Nspe-Nspe)2-NLys-Nspe-L-Pro-NLys-Nspe-Nspe-NH2 | Free | Amidation | Nlys = N-(4-aminobutyl)glycine, Nspe = (S)-N-(1-phenylethyl)glycine | Linear | 12 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 12.5-25 μM | In vitro | Raw 264.7 and J774 mouse macrophage | NA | LD50 = 50μM | NA | NA | NA | NA | NA | NA | NA | 2011 | 21464254 |
| antitb_1328 | 1-11mer | H-(NLys-Nspe-Nspe)3-NLys-Nspe-NH2 | Free | Amidation | Nlys = N-(4-aminobutyl)glycine, Nspe = (S)-N-(1-phenylethyl)glycine | Linear | 11 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 12.5-25 μM | In vitro | Raw 264.7 and J774 mouse macrophage | NA | LD50 = 50μM | NA | NA | NA | NA | NA | NA | NA | 2011 | 21464254 |
| antitb_1329 | 1-Nssb | H-(NLys-Nssb-Nssb)4-NH2 | Free | Amidation | Nlys = N-(4-aminobutyl)glycine, Nssb = (S)-N-(sec-butyl)glycine | Linear | 12 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = >100 μM | In vitro | Raw 264.7 and J774 mouse macrophage | NA | Non toxic | NA | NA | NA | NA | NA | NA | NA | 2011 | 21464254 |
| antitb_1330 | Human beta casein fragment (54-59) | VEPIPY | Free | Free | None | Linear | 6 | L | Cationic | Protein derived | Human beta casein protein | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 25μM | in vitro | THP 1 cell lines | Cells treated with 10 mM and 20 mM peptide showed 17.13% and 29.56% increase in clearance of BCG | NA | NA | NA | Increase expression of IL-8, MCP-1, MIP-1β, TNF-α | NA | NA | NA | NA | 2012 | 23029305 |
| antitb_1341 | Dihydromycoplanecin A | R-N(CH3)-CH(CH-CH3-CH3)-CO-N(CH-C-CH2-CH3-C-CH)-CO-N(CH3)-CH-C)-NH-CH(CH2-CH-CH3-CH3)-CO-N-CH-C-CH3_C-CH)-CONH-CH(CH2-CH2-CH-CH3-CH3)-Co-N-CH3-Ch-CH(CH3-CH3)-Co-N-(CH-C-Ch)-Co-N(CH3)-CH(CH2-CH-CH3-CH3)-CO-NH-CH2-CO-O-CH(CH3) | Propanol is attached | Free | R =CH3-CH2-CH(OH)-CO | Cyclic | 21 | Mix | NA | Natural | Aspergillus awajinensis | Mycobacterium bovis | Mycobacterium tuberculosis H37Rv | NA | Both | NA | NA | NA | ICR/JCL Mice | 15 mg/kg for mice and 50mg/kg for dog | NA | NA | NA | 4mg of DHMPA peptide+ 0.1 mg of Isoniazid | NA | 1988 | 3348603 |
| antitb_1399 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria bovis | Mycobacteria bovis BCG | MIC = 25μg/ml | in vitro | THP-1 cells | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1400 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria bovis | Mycobacteria bovis BCG | MIC = 25μg /ml (after 624hours incubation) | in vitro | THP-1 cells | > 60% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1655 | Trichoderins A1 | not available | NA | NA | NA | NA | 0 | NA | NA | Natural | Trichoderma species | Mycobacterium bovis BCG | Mycobacterium bovis BCG (aerobic) | IC90= 1.56 μg/ml | in vitro | Human THP-1 cell lines | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 2010 | 20483615 |
| antitb_1658 | Trichoderins A1 | not available | NA | NA | NA | NA | 0 | NA | NA | Natural | Trichoderma species | Mycobacterium bovis BCG | Mycobacterium bovis BCG (hypoxic) | IC90= 1.56 μg/ml | in vitro | Human THP-1 cell lines | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 2010 | 20483615 |
| antitb_1661 | Trichoderins A1 | not available | NA | NA | NA | NA | 0 | NA | NA | Natural | Trichoderma species | Mycobacterium bovis BCG | Mycobacterium bovis BCG (aerobic) | IC90= 0.16 μg/ml | in vitro | Human THP-1 cell lines | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 2010 | 20483615 |
| antitb_1664 | Trichoderins A1 | not available | NA | NA | NA | NA | 0 | NA | NA | Natural | Trichoderma species | Mycobacterium bovis BCG | Mycobacterium bovis BCG (hypoxic) | IC90= 0.16 μg/ml | in vitro | Human THP-1 cell lines | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 2010 | 20483615 |
| antitb_1667 | Trichoderins A1 | not available | NA | NA | NA | NA | 0 | NA | NA | Natural | Trichoderma species | Mycobacterium bovis BCG | Mycobacterium bovis BCG (aerobic) | IC90= 2.0 μg/ml | in vitro | Human THP-1 cell lines | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 2010 | 20483615 |
| antitb_1670 | Trichoderins A1 | not available | NA | NA | NA | NA | 0 | NA | NA | Natural | Trichoderma species | Mycobacterium bovis BCG | Mycobacterium bovis BCG (hypoxic) | IC90= 2.0 μg/ml | in vitro | Human THP-1 cell lines | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 2010 | 20483615 |
| antitb_1674 | Wollamides 2 | WLL-allo-ING | NA | NA | Fourth amino acid is allolysine and form cyclic structure with 1st and 6th | Cyclic | 6 | D | Cationic | Natural | Streptomyces species MST-115088 | Mycobacterium bovis | Mycobacterium bovis BCG | NA | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against staphylococcus aureus and bacillus subtilis | 2014 | 25229313 |
| antitb_1675 | Wollamides 5 | WLLVNG | Free | Free | NA | Cyclic | 6 | D | Cationic | Natural | Streptomyces species MST-115088 | Mycobacterium bovis | Mycobacterium bovis BCG | IC50 = 2.8 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against staphylococcus aureus and bacillus subtilis | 2014 | 25229313 |
| antitb_1676 | Wollamides 6 | WLV-allo-ING | Free | Free | Fourth amino acid is allolysine and form cyclic structure with 1st and 6th | Cyclic | 6 | D | Cationic | Natural | Streptomyces species MST-115088 | Mycobacterium bovis | Mycobacterium bovis BCG | IC50 = 3.1 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against staphylococcus aureus and bacillus subtilis | 2014 | 25229313 |
| antitb_1694 | Tuberactinamine N | not available | NA | NA | None | NA | 0 | NA | NA | Natural | Streptomyces griseoverticillatus var. tuberacticus | Mycobacterium bovis | Mycobacterium bovis BCG | Reduction in CFU at 12.5 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Bactericidal against corneybacterium diptheriae, bacillus subtilis, E.coli, Salmonellatyphosa, klebsiella pneumoniare,proteus vulgaris | 1975 | 28292 |
| antitb_1695 | Tuberactinomycin N | not available | NA | NA | None | NA | 0 | NA | NA | Natural | Streptomyces griseoverticillatus var. tuberacticus | Mycobacterium bovis | Mycobacterium bovis BCG | Reduction in CFU 25μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Bactericidal against corneybacterium diptheriae, bacillus subtilis, E.coli, Salmonellatyphosa, klebsiella pneumoniare,proteus vulgaris | 1975 | 28292 |
| antitb_1696 | Tuberactinamine N | not available | NA | NA | None | NA | 0 | NA | NA | Natural | Streptomyces griseoverticillatus var. tuberacticus | Mycobacterium bovis | Mycobacterium bovis BCG | Reduction in CFU at 25 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Bactericidal against corneybacterium diptheriae, bacillus subtilis, E.coli, Salmonellatyphosa, klebsiella pneumoniare,proteus vulgaris | 1975 | 28292 |
| antitb_1697 | Tuberactinomycin N | not available | NA | NA | None | NA | 0 | NA | NA | Natural | Streptomyces griseoverticillatus var. tuberacticus | Mycobacterium bovis | Mycobacterium bovis BCG | Reduction in CFU at 50 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Bactericidal against corneybacterium diptheriae, bacillus subtilis, E.coli, Salmonellatyphosa, klebsiella pneumoniare,proteus vulgaris | 1975 | 28292 |
| antitb_1698 | Tuberactinamine N | not available | NA | NA | None | NA | 0 | NA | NA | Natural | Streptomyces griseoverticillatus var. tuberacticus | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 50 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Bactericidal against corneybacterium diptheriae, bacillus subtilis, E.coli, Salmonellatyphosa, klebsiella pneumoniare,proteus vulgaris | 1975 | 28292 |
| antitb_1699 | Tuberactinomycin N | not available | NA | NA | None | NA | 0 | NA | NA | Natural | Streptomyces griseoverticillatus var. tuberacticus | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 100 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Bactericidal against corneybacterium diptheriae, bacillus subtilis, E.coli, Salmonellatyphosa, klebsiella pneumoniare,proteus vulgaris | 1975 | 28292 |
| antitb_1700 | Tuberactinamine N | not available | NA | NA | None | NA | 0 | NA | NA | Natural | Streptomyces griseoverticillatus var. tuberacticus | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 100 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Bactericidal against corneybacterium diptheriae, bacillus subtilis, E.coli, Salmonellatyphosa, klebsiella pneumoniare,proteus vulgaris | 1975 | 28292 |
| antitb_1701 | Tuberactinamine N | not available | NA | NA | None | NA | 0 | NA | NA | Natural | Streptomyces griseoverticillatus var. tuberacticus | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 6.3 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Bactericidal against corneybacterium diptheriae, bacillus subtilis, E.coli, Salmonellatyphosa, klebsiella pneumoniare,proteus vulgaris | 1975 | 28292 |
| antitb_1807 | NK-3 | KILRGVCKKIMRTFLRRISKDILTGKK | Free | Amidation | None | Linear | 27 | L | Cationic | Protein Derived | Core region of the lymphocytic effector protein NK-lysin | Mycobacterium bovis | Mycobacterium bovis BCG Pasteur (ATCC35734) | After 24 h, more than 78% killing was observed at 30 μM | In vitro | mouse macrophage RAW 264.8 | 11 μM NK-2 diminished the intracellular bacterial loadwhen compared to the untreated macrophages | Non-toxic | NA | NA | NA | NA | NA | NA | NA | 2011 | 21396418 |
| antitb_1809 | Ci-MAM-A25 | WRSLGRTLLRLSHALKPLARRSGW | Free | Amidation | None | Linear | 24 | L | Cationic | Protein Derived | Derived from immune cells of Ciona intestinalis, | Mycobacterium bovis | Mycobacterium bovis BCG Pasteur (ATCC35734) | After 24 h, more than 78% killing was observed at 30 μM | In vitro | mouse macrophage RAW 264.10 | NA | Slight toxic (two-fold decrease in cell viability was observed at 50 μM | NA | NA | NA | NA | NA | NA | NA | 2011 | 21396418 |
| antitb_1885 | Trichoderins A | PXXXIVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 0.02 μg/ml | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1888 | Trichoderins A | PXXXIVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 0.16 μg/ml | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1891 | Trichoderin B | PXXXVVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 0.02 μg/ml | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1914 | None | ILSLRWRWKWWKK | Free | Free | None | Linear | 13 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG pasteur strain | MIC = 32 μM | In vitro | J774.16 mouse macrophages and A549 human lung epithelial cells | NA | No cytotoxicity against J774.16 mouse macrophages and A549 human lung epithelial cells | NA | NA | NA | NA | Lipid bilayer | NA | Antibacterial against Streptococcus pyogenes, Streptococcus agalactiae, Streptococcus pneumoniae ATCC 49619, Klebsiella pneumoniae, Pseudomonas aeruginosa ATCC 27853, Bacillus subtilis BGSC 1A1. | 2016 | 26902758 |
| antitb_1966 | HIDFS1 | GFGCPFNARRCHRHCRSIRRRAGYCAGRLRLTCTCVR | Free | Free | None | Linear | 37 | L | Cationic | Natural | Derived from Haemaphysalis longicornis | Mycobacterium bovis | Mycobacterium bovis | MIC50 = 0.2 μM | In vitro | A549, 293 T, K562 and THP1 cells | NA | No cytotoxicity at 20 μM | NA | NA | NA | NA | NA | NA | Antiibacterial against Bacillus pumilus, Micrococcus luteus, Pseudomonas aeruginosa, Escherichia coli | 2017 | 28446822 |
| antitb_1967 | HIDFS2 | GFGCPLNQGACHRHCRSIRRRGGYCSGIIKQTCY | Free | Free | None | Linear | 34 | L | Cationic | Natural | Derived from Haemaphysalis longicornis | Mycobacterium bovis | Mycobacterium bovis | MIC50 = 0.5μM | In vitro | A549, 293 T, K562 and THP1 cells | NA | No cytotoxicity at 20 μM | NA | NA | NA | NA | NA | NA | Antiibacterial against Bacillus pumilus, Micrococcus luteus, Pseudomonas aeruginosa, Escherichia coli | 2017 | 28446822 |
| antitb_1968 | HIDFS1 | GFGCPFNARRCHRHCRSIRRRAGYCAGRLRLTCTCVR | Free | Free | None | Linear | 37 | L | Cationic | Natural | Derived from Haemaphysalis longicornis | Mycobacterium bovis | Mycobacterium bovis | MIC50 = 0.5 μM | In vitro | A549, 293 T, K562 and THP1 cells | NA | No cytotoxicity at 20 μM | NA | NA | NA | NA | NA | NA | Antiibacterial against Bacillus pumilus, Micrococcus luteus, Pseudomonas aeruginosa, Escherichia coli | 2017 | 28446822 |
| antitb_1969 | HIDFS2 | GFGCPLNQGACHRHCRSIRRRGGYCSGIIKQTCY | Free | Free | None | Linear | 34 | L | Cationic | Natural | Derived from Haemaphysalis longicornis | Mycobacterium bovis | Mycobacterium bovis | MIC50 = 0.5μM | In vitro | A549, 293 T, K562 and THP1 cells | NA | No cytotoxicity at 20 μM | NA | NA | NA | NA | NA | NA | Antiibacterial against Bacillus pumilus, Micrococcus luteus, Pseudomonas aeruginosa, Escherichia coli | 2017 | 28446822 |
| antitb_1989 | Ds-defensin | VPAESEAAHLRVRRGFGCPLNQGACHNHCRSIRRRGGYCSGIIKQTCTCYRN | Free | Free | None | Linear | 52 | L | NA | Natural | Dermacentor silvarum | Mycobacterium bovis | Mycobacterium bovis (carbenicillin-resistant strain) | MIC= 20 µM | In vitro | NA | NA | NA | NA | NA | NA | Bacterial lycis | Cell wall | NA | Four Gram-positive bacteria, namely, Staphylococcus aureus (CMCC26003), Bacillus pumilus (CMCC63202), Micrococcus luteus (CMCC63202), and Mycobacterium bovis (carbenicillin-resistant strain); and three Gram-negative bacteria, namely, Salmonella typhimurium (CVCC542), Pseudomonas aeruginosa (CVCC2000), and Escherichia coli (CMCC44103), | 2015 | 25588982 |