Browse result page of AntiTbPdb
The total number entries retrieved from this search are 60
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1017 | Ecumicin | (N,N-Me2-Val)-(Val)-(N-Me-allo-Ilu)-(Thr)-(N-Me-Thr)-(Val)-(N-Me-Leu)-(Val)-(N-Me-Val)-(N-Me-4-OMe-Trp)-(Val)-(Ph-threo-Ser)-(Val) | Free | Free | N-methylation pattern, N-Me-Val = N-methyl-valine, N,N-Me2-Val = N,N-dimethyl-valine, N-Me-Thr = N-methyl-threonine, N-Me-Leu = N-methyl-leucine, N-Me-allo-Ilu = N-methyl-isoleucine, N-Me-4-OMe-Trp = N-methyl-4-methoxy-tryptophan, Ph-threo-Ser = Phe | Macrocyclic | 13 | L | NA | Natural | Produced by a genetically distinct Nonomuraea species, strain MJM5123. | Mycobacterium avium | Mycobacterium avium (ATCC 15769) | MIC = 0.35 μM | In vitro | None | NA | NA | None | None | NA | Ecumicin markedly enhanced the ATPase activity of wild-type (WT) ClpC1 but prevented activation of proteolysis by ClpC1. so toxic proteins which are normally degraded by the ClpC1P1P2 complex, accumulate in the presence of ecumicin | ClpC1 ATPase complex | None | NA | 2015 | 25421483 |
| antitb_1147 | Nisin A | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region due to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium subsp. Hominissuis (CIT05/03) | NA | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
| antitb_1148 | Nisin A | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region due to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium paratuberculosis (ATCC 19698) | NA | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
| antitb_1152 | Nisin V | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANVK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium subsp. Hominissuis (CIT05/03) | 16% decrease in relative growth as compared to Nicin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
| antitb_1153 | Nisin V | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANVK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium paratuberculosis (ATCC 19698) | 23% decrease in relative growth as compared to Nicin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
| antitb_1157 | Nisin S | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMS-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium subsp. Hominissuis (CIT05/03) | 28% reductions in growth, relative to that brought about by nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
| antitb_1158 | Nisin S | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMS-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium paratuberculosis (ATCC 19698) | 19% decrease in growth as compare to the presence of Nicin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
| antitb_1162 | Nisin T | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMT-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium subsp. Hominissuis (CIT05/03) | 16% more inhibition as compared to nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
| antitb_1163 | Nisin T | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMT-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium paratuberculosis (ATCC 19698) | 27% decrease in growth relative to nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
| antitb_1164 | hLFcin1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Protein Derived | From human lactoferrin | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC50 = 15.8 ± 4.5 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1165 | hLFcin1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Protein Derived | From human lactoferrin | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC90 =34.6 ± 22.4 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1166 | hLFcin1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Protein Derived | From human lactoferrin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth transparent variant (SmT) | IC50 = 11.0 ± 4.1 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1167 | hLFcin1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Protein Derived | From human lactoferrin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth transparent variant (SmT) | IC90 = 65.8 ± 19.3 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1168 | hLFcin1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Protein Derived | From human lactoferrin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth doomed variant (SmD) | IC50 = 15.2 ± 2.9 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1169 | hLFcin1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Protein Derived | From human lactoferrin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth doomed variant (SmD) | IC90 =37.9 ± 15.9 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1170 | hLFcin1-11 all K | GKKKKSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Synthetic | NA | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC50 = 39.1 ± 6.9 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | None | 2014 | 24709266 |
| antitb_1171 | LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | From bovine lactoferricin | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC50 = 14.2 ± 1.5 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1172 | LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | From bovine lactoferricin | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC90 = 18.9 ± 4.0 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1173 | LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | From bovine lactoferricin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth transparent variant (SmT) | IC50 = 8.0 ± 1.5 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1174 | LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | From bovine lactoferricin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth transparent variant (SmT) | IC90 = 22.8 ± 9.1 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1175 | LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | From bovine lactoferricin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth doomed variant (SmD) | IC50 = 12.4 ± 0.3 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1176 | LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | From bovine lactoferricin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth doomed variant (SmD) | IC90 = 21.5 ± 4.0 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1177 | D-LFcin17-30 | fkcrrwqwrmkklg | Free | Free | None | Linear | 14 | D | Cationic | Synthetic | NA | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC50 = 10.7 ± 0.9 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | None | 2014 | 24709266 |
| antitb_1178 | D-LFcin17-30 | fkcrrwqwrmkklg | Free | Free | None | Linear | 14 | D | Cationic | Synthetic | NA | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC90 = 14.4 ± 1.9 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | None | 2014 | 24709266 |
| antitb_1179 | LFcin17-30 all K | FKCKKWQWKMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Synthetic | NA | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC50 = 18.0 ± 2.1 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | None | 2014 | 24709266 |
| antitb_1180 | LFcin17-30 all K | FKCKKWQWKMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Synthetic | NA | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC90 = 34.4 ± 8.2 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | None | 2014 | 24709266 |
| antitb_1181 | LFcin17-30 all R | FRCRRWQWRMRRLG | Free | Free | None | Linear | 14 | L | Cationic | Synthetic | NA | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC50 = 10.8 ± 1.6 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | None | 2014 | 24709266 |
| antitb_1182 | LFcin17-30 all R | FRCRRWQWRMRRLG | Free | Free | None | Linear | 14 | L | Cationic | Synthetic | NA | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC90 = 19.3 ± 4.8 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | None | 2014 | 24709266 |
| antitb_1217 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium avium | Mycobacterium avium subsp. Paratuberculosis | MIC = 0.125-0.25 μg/ml or 0.07-0.13 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
| antitb_1496 | Lacticin 3149 | not available | NA | NA | NA | Branched cyclic | 0 | D | Cationic | Natural | Derived from Lactococcuslactis | Mycobacterium avium | Mycobacterium avium subspecies paratuberculosis ATCC 19698 | IC90= 15mg/ml (±0.30) | in vitro | NA | NA | NA | NA | NA | NA | Inhibit biosynthesis of peptidoglycan and form pores in bacterial membrane | NA | NA | NA | 2015 | 25681127 |
| antitb_1499 | Nisin A | not available | NA | NA | NA | Branched cyclic | 0 | D | Cationic | Natural | Derived from Lactococcuslactis | Mycobacterium avium | Mycobacterium avium subspecies paratuberculosis ATCC 19698 | IC90= >60 mg/ml (± 2.02) | in vitro | NA | NA | NA | NA | NA | NA | Inhibit biosynthesis of peptidoglycan and form pores in bacterial membrane | NA | NA | NA | 2015 | 25681127 |
| antitb_1523 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Free | None | Linear | 39 | L | Cationic | Natural | Derived from pig porcine | Mycobacterium avium | Mycobacterium avium susceptible strain | MIC= 50 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 | |
| antitb_1551 | Lacticin 3147 | AA-(Dhb)-N-(Dhb)-FALADYWGNNGAWA-(Abu)-L-(Abu)-HEAMAWAK | Free | Free | Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid | Linear | 30 | L | Cationic | Natural | Derived from Lactococcus lactis | Mycobacterium avium | Mycobacterium avium | IC90= 60 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 25613372 |
| antitb_1682 | Cryomycin | not available | NA | NA | None | NA | 0 | NA | Weakly acidic | Natural | Streptomyces griseus subsp. psychrophilus, | Mycobacterium avium | Mycobacterium avium IFO 3 | MIC = 20 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against bacillus megaterium, E.coli, P.aeuroginosaand S.aureus,Antifungal Aspergillus niger, Mucor racemosus , Penicillium chrysogenum, Neurospora crassa | 1972 | 4630599 |
| antitb_1716 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium avium- mycobacterium intracellularae | Mycobacterium avium- mycobacterium intracellularae strain 25291 | Reduction in CFU at 5 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1992 | 1398982 |
| antitb_1717 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium avium- mycobacterium intracellularae | Mycobacterium avium- mycobacterium intracellularae strain 25291 | Reduction in CFU at 50 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1992 | 1398982 |
| antitb_1718 | Human neutrophil peptide (HNP-2) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys1-cys29, cys3-cys18,cys8-cys28 | 29 | L | Cationic | Natural | Human neutrophil | Mycobacterium avium- mycobacterium intracellularae | Mycobacterium avium- mycobacterium intracellularae strain 25291 | Reduction in bacterial load to 64 % at 5 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1992 | 1398982 | |
| antitb_1719 | Human neutrophil peptide (HNP-3) | DCYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium avium- mycobacterium intracellularae | Mycobacterium avium- mycobacterium intracellularae strain 25291 | Reduction in bacterial load to 61 % 5 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1992 | 1398982 | |
| antitb_1720 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium avium- mycobacterium intracellularae | Mycobacterium avium- mycobacterium intracellularae strain SJB | Reduction in CFU/well 91.8 ± 1.1 at peptide concentration 50μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1992 | 1398982 |
| antitb_1721 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium avium- mycobacterium intracellularae | Mycobacterium avium- mycobacterium intracellularae strain 292524 | Reduction in CFU/well70.6 ± 0.6 at peptide concentration 50μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1992 | 1398982 |
| antitb_1722 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium avium- mycobacterium intracellularae | Mycobacterium avium- mycobacterium intracellularae strain 475049 | Reduction in CFU/well 32.5 ± 10.7 at peptide concentration 50μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1992 | 1398982 |
| antitb_1893 | Human lactoferricin 1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Natural | Derived from human lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2447 smT | IC50 = 15.8 ± 4.5 μM | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1894 | Human lactoferricin 1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Natural | Derived from human lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2447 smT | IC90 = 34.6 ± 22.4 μM | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1895 | Human lactoferricin 1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Natural | Derived from human lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2-151 smT | IC50 = 11.0 ± 4.1 μM | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1896 | Human lactoferricin 1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Natural | Derived from human lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2-151 smT | IC90 = 65.8 ± 19.13 μM | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1897 | Human lactoferricin 1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Natural | Derived from human lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2-151 smD | IC50 = 15.2± 2.9 μM | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1898 | Human lactoferricin 1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Natural | Derived from human lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2-151 smD | IC90 = 37.9 ± 15.9 μM | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1899 | Human lactoferricin 1-11 | GKKKKSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Natural | Derived from human lactoferricin protein | Mycobacterium avium | Mycobacterium avium | Mycobacterium avium 2447 smT | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1900 | Bovine lactoferricin 17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2447 smT | IC50 = 14.2 ± 1.5 μM | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1901 | Bovine lactoferricin 17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2447 smT | IC90 = 18.9 ± 4.0 μM | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |