Browse result page of AntiTbPdb
The total number entries retrieved from this search are 279
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1652 | Human neutrohil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Synthetic | Human neutrophil | Mycobacterium Tuberculosis | Mycobacterium tuberculosis H37Rv | IC90 = 2.5 μg/ml | in vitro | murine macrophage-like cell line J744A.1 | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 2016 | 10933095 |
| antitb_1672 | Lariatin A | GSQLVYRWVGHSNVIKGP | Free | Free | Alpha carbon of glutamine form amide bond with first glycine and gamma carbon of glutamine involved in side chain formation | Cyclic | 18 | D | Cationic | Natural | Rhodococcus jostii B0171 | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC607 | MIC = 10 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2007 | 17617692 |
| antitb_1673 | Lariatin B | GSQLVYRWVGHSNVIKGP | Free | Free | Alpha carbon of glutamine form amide bond with first glycine and gamma carbon of glutamine involved in side chain formation | Cyclic | 18 | NA | Cationic | Natural | Rhodococcus jostii B0171 | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC607 | MIC = 10 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2007 | 17617692 |
| antitb_1674 | Wollamides 2 | WLL-allo-ING | NA | NA | Fourth amino acid is allolysine and form cyclic structure with 1st and 6th | Cyclic | 6 | D | Cationic | Natural | Streptomyces species MST-115088 | Mycobacterium bovis | Mycobacterium bovis BCG | NA | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against staphylococcus aureus and bacillus subtilis | 2014 | 25229313 |
| antitb_1675 | Wollamides 5 | WLLVNG | Free | Free | NA | Cyclic | 6 | D | Cationic | Natural | Streptomyces species MST-115088 | Mycobacterium bovis | Mycobacterium bovis BCG | IC50 = 2.8 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against staphylococcus aureus and bacillus subtilis | 2014 | 25229313 |
| antitb_1676 | Wollamides 6 | WLV-allo-ING | Free | Free | Fourth amino acid is allolysine and form cyclic structure with 1st and 6th | Cyclic | 6 | D | Cationic | Natural | Streptomyces species MST-115088 | Mycobacterium bovis | Mycobacterium bovis BCG | IC50 = 3.1 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against staphylococcus aureus and bacillus subtilis | 2014 | 25229313 |
| antitb_1677 | Globomycin | not available | NA | NA | NA | Cyclic | 0 | D | Cationic | Natural | Derived from streptomyces halstedii 13912 | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC607 | MIC = >100 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against bacillus sub!ills , E.coli, S.aureus Antifungal against Aspergillus oryzae SANK 11262, Candida albicans | 1977 | 353012 |
| antitb_1702 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium tuberculosis | Mycobacterium tuberculosis Ra 7632G | Reduction in CFU at 50 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 1996 | 8641802 |
| antitb_1703 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys30 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium tuberculosis | Mycobacterium tuberculosis Ra 9034G | Reduction in CFU at 50 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 1996 | 8641802 |
| antitb_1704 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys31 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium tuberculosis | Mycobacterium tuberculosis Ra 11170G | Reduction in CFU at 50 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 1996 | 8641802 |
| antitb_1708 | Porcine leucocyte peptide (PG-1) | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | porcine neutrophil leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis Ra 7632G | Reduction in CFU at 50 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 1996 | 8641802 |
| antitb_1709 | Porcine leucocyte peptide (PG-1) | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-14 | Cyclic | 18 | L | Cationic | Natural | porcine neutrophil leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis Ra 9034G | Reduction in CFU at 50 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 1996 | 8641802 |
| antitb_1710 | Porcine leucocyte peptide (PG-1) | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-15 | Cyclic | 18 | L | Cationic | Natural | porcine neutrophil leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis Ra 11170G | Reduction in CFU at 50 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 1996 | 8641802 |
| antitb_1711 | Porcine leucocyte peptide (PG-1) | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-16 | Cyclic | 18 | L | Cationic | Natural | porcine neutrophil leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37 Ra | IC50= 5 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 1996 | 8641802 |
| antitb_1712 | Porcine leucocyte peptide (PG-1) | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-17 | Cyclic | 18 | L | Cationic | Natural | porcine neutrophil leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37 Ra | MIC = 50 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 1996 | 8641802 |
| antitb_1713 | Ecumicin | (N,N-Me2-Val)-(Val)-(N-Me-allo-Ilu)-(Thr)-(N-Me-Thr)-(Val)-(N-Me-Leu)-(Val)-(N-Me-Val)-(N-Me-4-OMe-Trp)-(Val)-(Ph-threo-Ser)-(Val) | Free | Free | N-methylation pattern, N-Me-Val = N-methyl-valine, N,N-Me2-Val = N,N-dimethyl-valine, N-Me-Thr = N-methyl-threonine, N-Me-Leu = N-methyl-leucine, N-Me-allo-Ilu = N-methyl-isoleucine, N-Me-4-OMe-Trp = N-methyl-4-methoxy-tryptophan, Ph-threo-Ser = Phe | Macrocyclic | 13 | L | NA | Natural | Produced by a genetically distinct Nonomuraea species, strain MJM5123 | Mycobacterium tuberculosis | Mycobacterium Tuberculosis H37Rv resistant to streptomycin | IC90= < 0.20 μg/ml | Both | VERO cell line | 50 % bacteria is killed | No cytotoxicity | NA | NA | NA | NA | NA | NA | NA | 2014 | 25409285 |
| antitb_1714 | Ecumicin | (N,N-Me2-Val)-(Val)-(N-Me-allo-Ilu)-(Thr)-(N-Me-Thr)-(Val)-(N-Me-Leu)-(Val)-(N-Me-Val)-(N-Me-4-OMe-Trp)-(Val)-(Ph-threo-Ser)-(Val) | Free | Free | N-methylation pattern, N-Me-Val = N-methyl-valine, N,N-Me2-Val = N,N-dimethyl-valine, N-Me-Thr = N-methyl-threonine, N-Me-Leu = N-methyl-leucine, N-Me-allo-Ilu = N-methyl-isoleucine, N-Me-4-OMe-Trp = N-methyl-4-methoxy-tryptophan, Ph-threo-Ser = Phe | Macrocyclic | 13 | L | NA | Natural | Produced by a genetically distinct Nonomuraea species, strain MJM5124 | Mycobacterium tuberculosis | Mycobacterium Tuberculosis H37Rv resistant to rifampicin | IC90= 0.30 μg/ml | Both | VERO cell line | 51 % bacteria is killed | No cytotoxicity | NA | NA | NA | NA | NA | NA | NA | 2014 | 25409285 |
| antitb_1715 | Ecumicin | (N,N-Me2-Val)-(Val)-(N-Me-allo-Ilu)-(Thr)-(N-Me-Thr)-(Val)-(N-Me-Leu)-(Val)-(N-Me-Val)-(N-Me-4-OMe-Trp)-(Val)-(Ph-threo-Ser)-(Val) | Free | Free | N-methylation pattern, N-Me-Val = N-methyl-valine, N,N-Me2-Val = N,N-dimethyl-valine, N-Me-Thr = N-methyl-threonine, N-Me-Leu = N-methyl-leucine, N-Me-allo-Ilu = N-methyl-isoleucine, N-Me-4-OMe-Trp = N-methyl-4-methoxy-tryptophan, Ph-threo-Ser = Phe | Macrocyclic | 13 | L | NA | Natural | Produced by a genetically distinct Nonomuraea species, strain MJM5125 | Mycobacterium tuberculosis | Mycobacterium Tuberculosis H37Rv resistant to cycloserine | IC90= < 0.20μg/ml | Both | VERO cell line | 52 % bacteria is killed | No cytotoxicity | NA | NA | NA | NA | NA | NA | NA | 2014 | 25409285 |
| antitb_1716 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium avium- mycobacterium intracellularae | Mycobacterium avium- mycobacterium intracellularae strain 25291 | Reduction in CFU at 5 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1992 | 1398982 |
| antitb_1717 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium avium- mycobacterium intracellularae | Mycobacterium avium- mycobacterium intracellularae strain 25291 | Reduction in CFU at 50 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1992 | 1398982 |
| antitb_1720 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium avium- mycobacterium intracellularae | Mycobacterium avium- mycobacterium intracellularae strain SJB | Reduction in CFU/well 91.8 ± 1.1 at peptide concentration 50μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1992 | 1398982 |
| antitb_1721 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium avium- mycobacterium intracellularae | Mycobacterium avium- mycobacterium intracellularae strain 292524 | Reduction in CFU/well70.6 ± 0.6 at peptide concentration 50μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1992 | 1398982 |
| antitb_1722 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium avium- mycobacterium intracellularae | Mycobacterium avium- mycobacterium intracellularae strain 475049 | Reduction in CFU/well 32.5 ± 10.7 at peptide concentration 50μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1992 | 1398982 |
| antitb_1777 | Mitogenic defensin | MEKKSFAGLCFLFLVLFVAQECVLQTEAKTCENLADTFRGPCFATGNCDDHCKNKEHLLRGRCRDDFRCWCTRNC | Free | Free | Disulfide linkage | Cyclic | 75 | L | Cationic | Natural | From the seeds of white cloud beans (Phaseolus vulgaris cv. ‘white cloud bean’) | Mycobacterium phlei | Mycobacterium phlei | IC50 = 86 ± 6 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial, Antifungal | 2006 | 16687191 |
| antitb_1810 | Mcdef | GFGCPNDYSCSNHCRDSIGCRGGYCKYQLICTCYGCKKRRSIQE | Free | Free | 4 disulfide linkages between 4-25, 10-31, 14-33, 20-36 | Cyclic | 44 | L | Cationic | Protein Derived | detected in hemocytes of Manila clams (Ruditapes philippinarum). | Mycobacterium fortuitum | Mycobacterium fortuitum | MIC >20 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Staphylococcus aureus KCTC 1916, Streptococcus iniae KCTC 3651, orynebacterium diphtheriae, Bacillus subtilis, ibrio logei KCCM 12281, Vibrio salmonicida KCCM 41663) | 2011 | 21945146 |
| antitb_1832 | Hytramycin V | (METH-Ala)-(D-Pip)-L-(D-VAL)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 11.3 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1833 | Hytramycin V | (METH-Ala)-(D-Pip)-L-(D-VAL)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Clinical isolate, X004439 | MIC = 9.3 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1834 | Hytramycin V | (METH-Ala)-(D-Pip)-L-(D-VAL)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Clinical isolate, X004244 | MIC = 16.9 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1835 | Hytramycin V | (METH-Ala)-(D-Pip)-L-(D-VAL)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Clinical isolate, X005282 | MIC = 9.6 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1836 | Hytramycin V | (METH-Ala)-(D-Pip)-L-(D-VAL)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Clinical isolate, X005319 | MIC = 19.2 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1837 | Hytramycin V | (METH-Ala)-(D-Pip)-L-(D-VAL)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Clinical isolate, X001354 | MIC = 9.7 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1838 | Hytramycin V | (METH-Ala)-(D-Pip)-L-(D-VAL)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Clinical isolate, X003899 | MIC = 22.9 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1839 | Hytramycin V | (METH-Ala)-(D-Pip)-L-(D-VAL)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to streptomycin (rSM, ATCC 35820) | MIC = 11.6 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1840 | Hytramycin V | (METH-Ala)-(D-Pip)-L-(D-VAL)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to rifampin (rRMP, ATCC 35838) | MIC = 9.6 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1841 | Hytramycin V | (METH-Ala)-(D-Pip)-L-(D-VAL)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to kanamycin (rKM, ATCC 35827) | MIC = 12.4 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1842 | Hytramycin V | (METH-Ala)-(D-Pip)-L-(D-VAL)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to isoniazid (rINH, ATCC 35822) | MIC = 12.1 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1843 | Hytramycin V | (METH-Ala)-(D-Pip)-L-(D-VAL)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to cycloserine (rCS, ATCC 35826) | MIC = 20.6 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1844 | Hytramycin V | (METH-Ala)-(D-Pip)-L-(D-VAL)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to moxifloxacin (rMOX) | MIC = 9.0 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1845 | Hytramycin V | (METH-Ala)-(D-Pip)-L-(D-VAL)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to capreomycin (rCAP) | MIC = 12.1 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1846 | Hytramycin I | (METH-Ala)-(D-Pip)-L-( D-Allo-ILE)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties, D-Allo-ILE= D form of Allo-isoleucine | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 6.0 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1847 | Hytramycin I | (METH-Ala)-(D-Pip)-L-( D-Allo-ILE)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties, D-Allo-ILE= D form of Allo-isoleucine | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Clinical isolate, X004439 | MIC = 4.4 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1848 | Hytramycin I | (METH-Ala)-(D-Pip)-L-( D-Allo-ILE)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties, D-Allo-ILE= D form of Allo-isoleucine | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Clinical isolate, X004244 | MIC = 4.7 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1849 | Hytramycin I | (METH-Ala)-(D-Pip)-L-( D-Allo-ILE)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties, D-Allo-ILE= D form of Allo-isoleucine | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Clinical isolate, X005282 | MIC = 4.7 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1850 | Hytramycin I | (METH-Ala)-(D-Pip)-L-( D-Allo-ILE)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties, D-Allo-ILE= D form of Allo-isoleucine | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Clinical isolate, X005319 | MIC = 4.8 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1851 | Hytramycin I | (METH-Ala)-(D-Pip)-L-( D-Allo-ILE)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties, D-Allo-ILE= D form of Allo-isoleucine | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Clinical isolate, X001354 | MIC = 4.7 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1852 | Hytramycin I | (METH-Ala)-(D-Pip)-L-( D-Allo-ILE)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties, D-Allo-ILE= D form of Allo-isoleucine | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Clinical isolate, X003899 | MIC = 4.8 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1853 | Hytramycin I | (METH-Ala)-(D-Pip)-L-( D-Allo-ILE)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties, D-Allo-ILE= D form of Allo-isoleucine | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to streptomycin (rSM, ATCC 35820) | MIC = 4.7 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1854 | Hytramycin I | (METH-Ala)-(D-Pip)-L-( D-Allo-ILE)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties, D-Allo-ILE= D form of Allo-isoleucine | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to rifampin (rRMP, ATCC 35838) | MIC = 4.7 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1855 | Hytramycin I | (METH-Ala)-(D-Pip)-L-( D-Allo-ILE)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties, D-Allo-ILE= D form of Allo-isoleucine | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to kanamycin (rKM, ATCC 35827) | MIC = 4.9 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1856 | Hytramycin I | (METH-Ala)-(D-Pip)-L-( D-Allo-ILE)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties, D-Allo-ILE= D form of Allo-isoleucine | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to isoniazid (rINH, ATCC 35822) | MIC = 4.7 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |